Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
Location | 3758133..3758812 | Replicon | chromosome |
Accession | NZ_CP116071 | ||
Organism | Escherichia coli strain DETEC-S589 |
Toxin (Protein)
Gene name | higB | Uniprot ID | V0VBP6 |
Locus tag | PIC30_RS18870 | Protein ID | WP_000057524.1 |
Coordinates | 3758510..3758812 (-) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | S1QAY3 |
Locus tag | PIC30_RS18865 | Protein ID | WP_000806442.1 |
Coordinates | 3758133..3758474 (-) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIC30_RS18855 (3754377) | 3754377..3755309 | - | 933 | WP_000883052.1 | glutaminase A | - |
PIC30_RS18860 (3755571) | 3755571..3758075 | + | 2505 | WP_000083945.1 | copper-exporting P-type ATPase CopA | - |
PIC30_RS18865 (3758133) | 3758133..3758474 | - | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
PIC30_RS18870 (3758510) | 3758510..3758812 | - | 303 | WP_000057524.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PIC30_RS18875 (3758945) | 3758945..3759739 | + | 795 | WP_000365177.1 | TraB/GumN family protein | - |
PIC30_RS18880 (3759943) | 3759943..3760422 | + | 480 | WP_000186633.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
PIC30_RS18885 (3760590) | 3760590..3761246 | + | 657 | WP_001363258.1 | hypothetical protein | - |
PIC30_RS18890 (3761243) | 3761243..3761746 | + | 504 | WP_000667000.1 | hypothetical protein | - |
PIC30_RS18895 (3761784) | 3761784..3763436 | - | 1653 | WP_000771762.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 3750822..3761746 | 10924 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11839.47 Da Isoelectric Point: 10.2237
>T267793 WP_000057524.1 NZ_CP116071:c3758812-3758510 [Escherichia coli]
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHWDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHWDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|