Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hokW-rdlD/-
Location 2820120..2820345 Replicon chromosome
Accession NZ_CP116071
Organism Escherichia coli strain DETEC-S589

Toxin (Protein)


Gene name hokW Uniprot ID S1ELB5
Locus tag PIC30_RS13885 Protein ID WP_000813254.1
Coordinates 2820120..2820275 (-) Length 52 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2820287..2820345 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PIC30_RS13835 2815280..2815396 + 117 Protein_2714 hypothetical protein -
PIC30_RS13855 2815799..2816848 - 1050 WP_000935515.1 site-specific DNA-methyltransferase -
PIC30_RS13860 2816999..2817196 - 198 WP_000917749.1 hypothetical protein -
PIC30_RS13865 2817421..2818242 - 822 WP_000762880.1 antitermination protein -
PIC30_RS13870 2818239..2818613 - 375 WP_000904114.1 RusA family crossover junction endodeoxyribonuclease -
PIC30_RS13875 2818626..2819672 - 1047 WP_001265108.1 DUF968 domain-containing protein -
PIC30_RS13880 2819674..2819952 - 279 WP_011478175.1 hypothetical protein -
PIC30_RS13885 2820120..2820275 - 156 WP_000813254.1 type I toxin-antitoxin system toxin HokD Toxin
- 2820287..2820345 + 59 - - Antitoxin
PIC30_RS13890 2820893..2821894 - 1002 WP_000354966.1 hypothetical protein -
PIC30_RS13895 2821910..2822872 - 963 WP_014639476.1 hypothetical protein -
PIC30_RS13900 2823064..2823486 - 423 WP_001151216.1 DUF977 family protein -
PIC30_RS13905 2823527..2824597 - 1071 WP_001262357.1 hypothetical protein -
PIC30_RS13910 2824669..2825094 - 426 WP_000693867.1 toxin YdaT family protein -
PIC30_RS13915 2825078..2825320 - 243 WP_000747951.1 Cro/CI family transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2783397..2835938 52541


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(6-47)


Sequences

Toxin        


Download         Length: 52 a.a.        Molecular weight: 5736.89 Da        Isoelectric Point: 6.1531

>T267790 WP_000813254.1 NZ_CP116071:c2820275-2820120 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE

Download         Length: 156 bp

Antitoxin


Download         Length: 59 bp

>AT267790 NZ_CP116071:2820287-2820345 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TMW0

Antitoxin

Download structure file

References