Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hokW-rdlD/- |
| Location | 2820120..2820345 | Replicon | chromosome |
| Accession | NZ_CP116071 | ||
| Organism | Escherichia coli strain DETEC-S589 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | S1ELB5 |
| Locus tag | PIC30_RS13885 | Protein ID | WP_000813254.1 |
| Coordinates | 2820120..2820275 (-) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 2820287..2820345 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIC30_RS13835 | 2815280..2815396 | + | 117 | Protein_2714 | hypothetical protein | - |
| PIC30_RS13855 | 2815799..2816848 | - | 1050 | WP_000935515.1 | site-specific DNA-methyltransferase | - |
| PIC30_RS13860 | 2816999..2817196 | - | 198 | WP_000917749.1 | hypothetical protein | - |
| PIC30_RS13865 | 2817421..2818242 | - | 822 | WP_000762880.1 | antitermination protein | - |
| PIC30_RS13870 | 2818239..2818613 | - | 375 | WP_000904114.1 | RusA family crossover junction endodeoxyribonuclease | - |
| PIC30_RS13875 | 2818626..2819672 | - | 1047 | WP_001265108.1 | DUF968 domain-containing protein | - |
| PIC30_RS13880 | 2819674..2819952 | - | 279 | WP_011478175.1 | hypothetical protein | - |
| PIC30_RS13885 | 2820120..2820275 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| - | 2820287..2820345 | + | 59 | - | - | Antitoxin |
| PIC30_RS13890 | 2820893..2821894 | - | 1002 | WP_000354966.1 | hypothetical protein | - |
| PIC30_RS13895 | 2821910..2822872 | - | 963 | WP_014639476.1 | hypothetical protein | - |
| PIC30_RS13900 | 2823064..2823486 | - | 423 | WP_001151216.1 | DUF977 family protein | - |
| PIC30_RS13905 | 2823527..2824597 | - | 1071 | WP_001262357.1 | hypothetical protein | - |
| PIC30_RS13910 | 2824669..2825094 | - | 426 | WP_000693867.1 | toxin YdaT family protein | - |
| PIC30_RS13915 | 2825078..2825320 | - | 243 | WP_000747951.1 | Cro/CI family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2783397..2835938 | 52541 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T267790 WP_000813254.1 NZ_CP116071:c2820275-2820120 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
Antitoxin
Download Length: 59 bp
>AT267790 NZ_CP116071:2820287-2820345 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|