Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 3602547..3603149 | Replicon | chromosome |
Accession | NZ_CP116067 | ||
Organism | Escherichia coli strain DETEC-S792 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | PID00_RS18010 | Protein ID | WP_096122058.1 |
Coordinates | 3602547..3602858 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PID00_RS18015 | Protein ID | WP_000356397.1 |
Coordinates | 3602859..3603149 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PID00_RS17985 (3598461) | 3598461..3599060 | + | 600 | WP_001296610.1 | glucose-1-phosphatase | - |
PID00_RS17990 (3599054) | 3599054..3599926 | + | 873 | WP_000920763.1 | virulence factor BrkB family protein | - |
PID00_RS17995 (3599923) | 3599923..3600360 | + | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
PID00_RS18000 (3600405) | 3600405..3601346 | + | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
PID00_RS18005 (3601410) | 3601410..3602318 | - | 909 | WP_001385591.1 | alpha/beta hydrolase | - |
PID00_RS18010 (3602547) | 3602547..3602858 | + | 312 | WP_096122058.1 | toxin HigB-2 | Toxin |
PID00_RS18015 (3602859) | 3602859..3603149 | + | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
PID00_RS18020 (3603754) | 3603754..3603972 | + | 219 | WP_001298592.1 | CopG family transcriptional regulator | - |
PID00_RS18025 (3604187) | 3604187..3605116 | - | 930 | WP_000027720.1 | formate dehydrogenase accessory protein FdhE | - |
PID00_RS18030 (3605113) | 3605113..3605748 | - | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
PID00_RS18035 (3605745) | 3605745..3606647 | - | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12274.27 Da Isoelectric Point: 9.7791
>T267764 WP_096122058.1 NZ_CP116067:3602547-3602858 [Escherichia coli]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGRLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLQLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGRLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLQLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|