Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 2762412..2763211 | Replicon | chromosome |
| Accession | NZ_CP116067 | ||
| Organism | Escherichia coli strain DETEC-S792 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | S1NYM6 |
| Locus tag | PID00_RS13930 | Protein ID | WP_000347251.1 |
| Coordinates | 2762747..2763211 (+) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | S1EB98 |
| Locus tag | PID00_RS13925 | Protein ID | WP_001307405.1 |
| Coordinates | 2762412..2762747 (+) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PID00_RS13910 (2758197) | 2758197..2758967 | - | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
| PID00_RS13915 (2758983) | 2758983..2760317 | - | 1335 | WP_000599654.1 | galactarate/glucarate/glycerate transporter GarP | - |
| PID00_RS13920 (2760692) | 2760692..2762263 | + | 1572 | WP_001559982.1 | galactarate dehydratase | - |
| PID00_RS13925 (2762412) | 2762412..2762747 | + | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| PID00_RS13930 (2762747) | 2762747..2763211 | + | 465 | WP_000347251.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| PID00_RS13935 (2763266) | 2763266..2764075 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
| PID00_RS13940 (2764324) | 2764324..2765604 | + | 1281 | WP_001562147.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| PID00_RS13945 (2765627) | 2765627..2766100 | + | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| PID00_RS13950 (2766111) | 2766111..2766890 | + | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| PID00_RS13955 (2766880) | 2766880..2767758 | + | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| PID00_RS13960 (2767776) | 2767776..2768210 | + | 435 | WP_000948823.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 2754716..2763211 | 8495 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17777.14 Da Isoelectric Point: 9.4947
>T267760 WP_000347251.1 NZ_CP116067:2762747-2763211 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CJ20 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XVC7 |