Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/Tad-HTH_37
Location 865521..866049 Replicon chromosome
Accession NZ_CP116067
Organism Escherichia coli strain DETEC-S792

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag PID00_RS04460 Protein ID WP_233010624.1
Coordinates 865521..865751 (+) Length 77 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag PID00_RS04465 Protein ID WP_000147082.1
Coordinates 865741..866049 (+) Length 103 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PID00_RS04415 (860894) 860894..860966 + 73 Protein_870 hypothetical protein -
PID00_RS04420 (862058) 862058..862672 - 615 WP_001241329.1 hypothetical protein -
PID00_RS04425 (862672) 862672..862914 - 243 WP_001624519.1 hypothetical protein -
PID00_RS04430 (862907) 862907..863107 - 201 WP_000994506.1 protein ninH -
PID00_RS04435 (863104) 863104..863466 - 363 WP_001624518.1 RusA family crossover junction endodeoxyribonuclease -
PID00_RS04440 (863463) 863463..863753 - 291 WP_024194163.1 DUF1364 domain-containing protein -
PID00_RS04445 (863777) 863777..863968 - 192 WP_001254269.1 NinE family protein -
PID00_RS04450 (863965) 863965..864375 - 411 WP_001076830.1 recombination protein NinB -
PID00_RS04455 (864430) 864430..865104 - 675 WP_021571289.1 ORF6N domain-containing protein -
PID00_RS04460 (865521) 865521..865751 + 231 WP_233010624.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PID00_RS04465 (865741) 865741..866049 + 309 WP_000147082.1 helix-turn-helix transcriptional regulator Antitoxin
PID00_RS04470 (866104) 866104..866349 - 246 WP_001624507.1 hypothetical protein -
PID00_RS04475 (866348) 866348..867022 + 675 WP_032144013.1 DUF4145 domain-containing protein -
PID00_RS04480 (867055) 867055..867486 - 432 WP_000196185.1 DUF977 family protein -
PID00_RS04485 (867502) 867502..868272 - 771 WP_046623299.1 DUF1627 domain-containing protein -
PID00_RS04490 (868298) 868298..869038 - 741 WP_021571292.1 ATP-binding protein -
PID00_RS04495 (869045) 869045..870139 - 1095 WP_096122401.1 DNA-binding protein -
PID00_RS04500 (870160) 870160..870378 - 219 WP_000438870.1 hypothetical protein -
PID00_RS04505 (870393) 870393..870689 - 297 WP_000084293.1 CII family transcriptional regulator -
PID00_RS04510 (870806) 870806..871030 - 225 WP_001054988.1 helix-turn-helix domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 756008..907268 151260


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(5-70)

Antitoxin

Cro/C1-type helix-turn-helix domain

(44-97)


Sequences

Toxin        


Download         Length: 77 a.a.        Molecular weight: 8706.22 Da        Isoelectric Point: 10.5886

>T267751 WP_233010624.1 NZ_CP116067:865521-865751 [Escherichia coli]
MRIYGANLGSPHTEAFGDGLFEIRLKGSEGIGRVFYCTLKGKRIIMLHSFVKKTQKTPPAELRKAETRMKEVKHDW

Download         Length: 231 bp

Antitoxin


Download         Length: 103 a.a.        Molecular weight: 11079.81 Da        Isoelectric Point: 9.7256

>AT267751 WP_000147082.1 NZ_CP116067:865741-866049 [Escherichia coli]
MTGKRTPPTMTHDEMVEKMLSNPAVKAEYDAIADEFALLDEMLAARKEAGLTQAEVAERMGTKATAITRMESNLASGTSG
PSFATLKKFARATGKKLQIRFV

Download         Length: 309 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References