Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 68166..68419 | Replicon | plasmid p812A1-69K |
| Accession | NZ_CP116048 | ||
| Organism | Escherichia coli strain EC812A1 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | PIH14_RS24075 | Protein ID | WP_001312851.1 |
| Coordinates | 68270..68419 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 68166..68225 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIH14_RS24050 (64893) | 64893..65639 | + | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
| PIH14_RS24055 (65694) | 65694..66254 | + | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| PIH14_RS24060 (66386) | 66386..66586 | + | 201 | WP_015059022.1 | hypothetical protein | - |
| PIH14_RS24065 (66972) | 66972..67571 | + | 600 | WP_032083981.1 | PIN domain-containing protein | - |
| PIH14_RS24070 (67633) | 67633..67965 | + | 333 | WP_152916585.1 | hypothetical protein | - |
| - (68166) | 68166..68225 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (68166) | 68166..68225 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (68166) | 68166..68225 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (68166) | 68166..68225 | - | 60 | NuclAT_1 | - | Antitoxin |
| PIH14_RS24075 (68270) | 68270..68419 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| PIH14_RS24080 (68703) | 68703..68951 | + | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | rmtB / blaTEM-1B / blaCTX-M-55 | - | 1..69262 | 69262 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T267745 WP_001312851.1 NZ_CP116048:68270-68419 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT267745 NZ_CP116048:c68225-68166 [Escherichia coli]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|