Detailed information of TA system TA267743

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 28679..28948
• Replicon: plasmid p812A1-69K
• Accession: NZ_CP116048
• Organism: Escherichia coli strain EC812A1

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: PIH14_RS23845
• Protein ID: WP_001372321.1
• Coordinates: 28823..28948 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	28679..28744 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
PIH14_RS23810	24389..24916	+	528	WP_000290834.1	single-stranded DNA-binding protein	-
PIH14_RS23815	24974..25207	+	234	WP_000006003.1	DUF905 family protein	-
PIH14_RS23820	25268..27291	+	2024	Protein_34	ParB/RepB/Spo0J family partition protein	-
PIH14_RS23825	27360..27794	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
PIH14_RS23830	27791..28553	+	763	Protein_36	plasmid SOS inhibition protein A	-
-	28522..28746	+	225	NuclAT_0	-	-
-	28522..28746	+	225	NuclAT_0	-	-
-	28522..28746	+	225	NuclAT_0	-	-
-	28522..28746	+	225	NuclAT_0	-	-
PIH14_RS23835	28531..28710	-	180	WP_001309233.1	hypothetical protein	-
-	28679..28744	-	66	-	-	Antitoxin
PIH14_RS23840	28732..28881	+	150	Protein_38	plasmid maintenance protein Mok	-
PIH14_RS23845	28823..28948	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
PIH14_RS23850	29267..29563	-	297	Protein_40	hypothetical protein	-
PIH14_RS23855	29863..30159	+	297	WP_001272251.1	hypothetical protein	-
PIH14_RS23860	30270..31091	+	822	WP_001234445.1	DUF932 domain-containing protein	-
PIH14_RS23865	31388..32035	-	648	WP_015059008.1	transglycosylase SLT domain-containing protein	-
PIH14_RS23870	32312..32695	+	384	WP_000124981.1	conjugal transfer relaxosome DNA-binding protein TraM	-
PIH14_RS23875	32886..33572	+	687	WP_015059009.1	PAS domain-containing protein	-
PIH14_RS23880	33666..33893	+	228	WP_001254386.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	rmtB / blaTEM-1B / blaCTX-M-55	-	1..69262	69262

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T267743 WP_001372321.1 NZ_CP116048:28823-28948 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT267743 NZ_CP116048:c28744-28679 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin