Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 3992488..3993182 | Replicon | chromosome |
Accession | NZ_CP116046 | ||
Organism | Escherichia coli strain EC812A1 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | S1EXB8 |
Locus tag | PIH14_RS19290 | Protein ID | WP_001263493.1 |
Coordinates | 3992784..3993182 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | - |
Locus tag | PIH14_RS19285 | Protein ID | WP_032162515.1 |
Coordinates | 3992488..3992781 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIH14_RS19265 (3988120) | 3988120..3988617 | + | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
PIH14_RS19270 (3988841) | 3988841..3990553 | - | 1713 | Protein_3754 | flagellar biosynthesis protein FlhA | - |
PIH14_RS19275 (3990525) | 3990525..3991310 | + | 786 | WP_000207587.1 | putative lateral flagellar export/assembly protein LafU | - |
PIH14_RS19280 (3991381) | 3991381..3992436 | + | 1056 | WP_032162516.1 | DNA polymerase IV | - |
PIH14_RS19285 (3992488) | 3992488..3992781 | + | 294 | WP_032162515.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
PIH14_RS19290 (3992784) | 3992784..3993182 | + | 399 | WP_001263493.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
PIH14_RS19295 (3993192) | 3993192..3993644 | + | 453 | WP_001059847.1 | GNAT family N-acetyltransferase | - |
PIH14_RS19300 (3993890) | 3993890..3994093 | + | 204 | Protein_3760 | RtcB family protein | - |
PIH14_RS19305 (3994092) | 3994092..3994613 | + | 522 | Protein_3761 | peptide chain release factor H | - |
PIH14_RS19310 (3994670) | 3994670..3996127 | - | 1458 | WP_001293003.1 | cytosol nonspecific dipeptidase | - |
PIH14_RS19315 (3996388) | 3996388..3996846 | + | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
- (3997442) | 3997442..3997522 | + | 81 | NuclAT_10 | - | - |
- (3997442) | 3997442..3997522 | + | 81 | NuclAT_10 | - | - |
- (3997442) | 3997442..3997522 | + | 81 | NuclAT_10 | - | - |
- (3997442) | 3997442..3997522 | + | 81 | NuclAT_10 | - | - |
PIH14_RS19320 (3996938) | 3996938..3998182 | + | 1245 | WP_000189541.1 | esterase FrsA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15472.83 Da Isoelectric Point: 8.0949
>T267741 WP_001263493.1 NZ_CP116046:3992784-3993182 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|