Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 3422073..3422905 | Replicon | chromosome |
Accession | NZ_CP116046 | ||
Organism | Escherichia coli strain EC812A1 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | S1PD64 |
Locus tag | PIH14_RS16505 | Protein ID | WP_000854753.1 |
Coordinates | 3422073..3422447 (-) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | E3PJ72 |
Locus tag | PIH14_RS16510 | Protein ID | WP_001278232.1 |
Coordinates | 3422537..3422905 (-) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIH14_RS16490 (3417737) | 3417737..3419071 | - | 1335 | WP_000092909.1 | cadaverine/lysine antiporter | - |
PIH14_RS16495 (3419436) | 3419436..3420974 | - | 1539 | WP_001187173.1 | lysine decarboxylation/transport transcriptional activator CadC | - |
PIH14_RS16500 (3421723) | 3421723..3422076 | - | 354 | WP_071685956.1 | DUF5983 family protein | - |
PIH14_RS16505 (3422073) | 3422073..3422447 | - | 375 | WP_000854753.1 | TA system toxin CbtA family protein | Toxin |
PIH14_RS16510 (3422537) | 3422537..3422905 | - | 369 | WP_001278232.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
PIH14_RS16515 (3423068) | 3423068..3423289 | - | 222 | WP_000692311.1 | DUF987 domain-containing protein | - |
PIH14_RS16520 (3423352) | 3423352..3423828 | - | 477 | WP_001186770.1 | RadC family protein | - |
PIH14_RS16525 (3423844) | 3423844..3424329 | - | 486 | WP_000849576.1 | antirestriction protein | - |
PIH14_RS16530 (3424384) | 3424384..3425202 | - | 819 | WP_001234620.1 | DUF932 domain-containing protein | - |
PIH14_RS16535 (3425302) | 3425302..3425535 | - | 234 | WP_001119729.1 | DUF905 family protein | - |
PIH14_RS16540 (3425614) | 3425614..3426069 | - | 456 | WP_000581504.1 | IrmA family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 3411948..3424329 | 12381 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14005.00 Da Isoelectric Point: 8.2905
>T267738 WP_000854753.1 NZ_CP116046:c3422447-3422073 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13491.37 Da Isoelectric Point: 6.6290
>AT267738 WP_001278232.1 NZ_CP116046:c3422905-3422537 [Escherichia coli]
VSDALSGTMLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
VSDALSGTMLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LVU0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | E3PJ72 |