Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
| Location | 2138925..2139618 | Replicon | chromosome |
| Accession | NZ_CP116046 | ||
| Organism | Escherichia coli strain EC812A1 | ||
Toxin (Protein)
| Gene name | mqsR | Uniprot ID | S1EZG2 |
| Locus tag | PIH14_RS10430 | Protein ID | WP_000415584.1 |
| Coordinates | 2139322..2139618 (-) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | mqsA | Uniprot ID | S1EBV2 |
| Locus tag | PIH14_RS10425 | Protein ID | WP_000650107.1 |
| Coordinates | 2138925..2139320 (-) | Length | 132 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIH14_RS10415 (2134789) | 2134789..2137047 | - | 2259 | WP_088213288.1 | DNA topoisomerase IV subunit A | - |
| PIH14_RS10420 (2137185) | 2137185..2138792 | - | 1608 | WP_088213289.1 | ABC transporter substrate-binding protein | - |
| PIH14_RS10425 (2138925) | 2138925..2139320 | - | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
| PIH14_RS10430 (2139322) | 2139322..2139618 | - | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
| PIH14_RS10435 (2139823) | 2139823..2140305 | - | 483 | WP_000183505.1 | GyrI-like domain-containing protein | - |
| PIH14_RS10440 (2140358) | 2140358..2140750 | - | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
| PIH14_RS10445 (2140902) | 2140902..2141561 | + | 660 | WP_001221493.1 | quorum sensing response regulator transcription factor QseB | - |
| PIH14_RS10450 (2141558) | 2141558..2142907 | + | 1350 | WP_001618857.1 | quorum sensing histidine kinase QseC | - |
| PIH14_RS10455 (2142953) | 2142953..2143285 | - | 333 | WP_000917684.1 | DUF2645 family protein | - |
| PIH14_RS10460 (2143604) | 2143604..2144185 | + | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
| PIH14_RS10465 (2144216) | 2144216..2144530 | + | 315 | WP_000958598.1 | putative quinol monooxygenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T267734 WP_000415584.1 NZ_CP116046:c2139618-2139322 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT267734 WP_000650107.1 NZ_CP116046:c2139320-2138925 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|