Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 4358662..4359461 | Replicon | chromosome |
| Accession | NZ_CP116044 | ||
| Organism | Escherichia coli strain STEC1575 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | V0SSH7 |
| Locus tag | PHA55_RS21225 | Protein ID | WP_000347273.1 |
| Coordinates | 4358997..4359461 (+) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | S1EB98 |
| Locus tag | PHA55_RS21220 | Protein ID | WP_001307405.1 |
| Coordinates | 4358662..4358997 (+) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PHA55_RS21205 (4354447) | 4354447..4355217 | - | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
| PHA55_RS21210 (4355233) | 4355233..4356567 | - | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
| PHA55_RS21215 (4356942) | 4356942..4358513 | + | 1572 | WP_001273741.1 | galactarate dehydratase | - |
| PHA55_RS21220 (4358662) | 4358662..4358997 | + | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| PHA55_RS21225 (4358997) | 4358997..4359461 | + | 465 | WP_000347273.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| PHA55_RS21230 (4359516) | 4359516..4360325 | - | 810 | WP_000072180.1 | aga operon transcriptional regulator AgaR | - |
| PHA55_RS21235 (4360574) | 4360574..4361854 | + | 1281 | WP_000681921.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| PHA55_RS21240 (4361877) | 4361877..4362350 | + | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| PHA55_RS21245 (4362361) | 4362361..4363140 | + | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| PHA55_RS21250 (4363130) | 4363130..4364008 | + | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| PHA55_RS21255 (4364026) | 4364026..4364460 | + | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4347672..4359461 | 11789 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17836.25 Da Isoelectric Point: 9.6924
>T267720 WP_000347273.1 NZ_CP116044:4358997-4359461 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V0SSH7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XVC7 |