Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ralRA/- |
| Location | 2302601..2302972 | Replicon | chromosome |
| Accession | NZ_CP116044 | ||
| Organism | Escherichia coli strain STEC1575 | ||
Toxin (Protein)
| Gene name | ralR | Uniprot ID | A0A839BBC2 |
| Locus tag | PHA55_RS11190 | Protein ID | WP_021500490.1 |
| Coordinates | 2302778..2302972 (-) | Length | 65 a.a. |
Antitoxin (RNA)
| Gene name | ralA | ||
| Locus tag | - | ||
| Coordinates | 2302601..2302779 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PHA55_RS11160 (2298353) | 2298353..2298526 | + | 174 | WP_001296046.1 | protein YnaL | - |
| PHA55_RS11165 (2298556) | 2298556..2299929 | + | 1374 | WP_000123720.1 | ATP-dependent RNA helicase DbpA | - |
| PHA55_RS11170 (2300058) | 2300058..2300993 | - | 936 | WP_001585625.1 | tRNA 2-thiocytidine(32) synthetase TtcA | - |
| PHA55_RS11175 (2301045) | 2301045..2302280 | - | 1236 | WP_072017917.1 | site-specific integrase | - |
| PHA55_RS11180 (2302282) | 2302282..2302497 | - | 216 | WP_000079604.1 | excisionase XisR | - |
| - (2302601) | 2302601..2302779 | + | 179 | NuclAT_0 | - | Antitoxin |
| - (2302601) | 2302601..2302779 | + | 179 | NuclAT_0 | - | Antitoxin |
| - (2302601) | 2302601..2302779 | + | 179 | NuclAT_0 | - | Antitoxin |
| - (2302601) | 2302601..2302779 | + | 179 | NuclAT_0 | - | Antitoxin |
| PHA55_RS11185 (2302597) | 2302597..2302785 | - | 189 | WP_001383994.1 | DUF1187 family protein | - |
| PHA55_RS11190 (2302778) | 2302778..2302972 | - | 195 | WP_021500490.1 | type I toxin-antitoxin system endodeoxyribonuclease toxin RalR | Toxin |
| PHA55_RS11195 (2303036) | 2303036..2304124 | - | 1089 | WP_021529594.1 | RecT family recombinase | - |
| PHA55_RS11200 (2304139) | 2304139..2307285 | - | 3147 | WP_161622427.1 | exodeoxyribonuclease VIII | - |
| PHA55_RS11205 (2307387) | 2307387..2307662 | - | 276 | WP_000632298.1 | hypothetical protein | - |
| PHA55_RS11210 (2307737) | 2307737..2307907 | - | 171 | WP_087907244.1 | YdaE family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2301045..2351218 | 50173 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 65 a.a. Molecular weight: 7046.98 Da Isoelectric Point: 9.2886
>T267706 WP_021500490.1 NZ_CP116044:c2302972-2302778 [Escherichia coli]
MRYEKVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
MRYEKVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
Download Length: 195 bp
Antitoxin
Download Length: 179 bp
>AT267706 NZ_CP116044:2302601-2302779 [Escherichia coli]
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTCCCTGA
GAGCATTTTTTCGCATTCCGATTTGGTTAACTTTGTTTTTGAGTACCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTCCCTGA
GAGCATTTTTTCGCATTCCGATTTGGTTAACTTTGTTTTTGAGTACCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
