Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-istR/Ldr(toxin)
Location 2162701..2162923 Replicon chromosome
Accession NZ_CP116044
Organism Escherichia coli strain STEC1575

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag PHA55_RS10470 Protein ID WP_000170965.1
Coordinates 2162701..2162808 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name istR
Locus tag -
Coordinates 2162856..2162923 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PHA55_RS10440 (2158556) 2158556..2159389 + 834 WP_000456571.1 peptide chain release factor N(5)-glutamine methyltransferase -
PHA55_RS10445 (2159386) 2159386..2159778 + 393 WP_000200392.1 invasion regulator SirB2 -
PHA55_RS10450 (2159782) 2159782..2160591 + 810 WP_001257044.1 invasion regulator SirB1 -
PHA55_RS10455 (2160627) 2160627..2161481 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
PHA55_RS10460 (2161630) 2161630..2161737 - 108 WP_176258838.1 type I toxin-antitoxin system toxin Ldr family protein -
- (2161787) 2161787..2161850 + 64 NuclAT_40 - -
- (2161787) 2161787..2161850 + 64 NuclAT_40 - -
- (2161787) 2161787..2161850 + 64 NuclAT_40 - -
- (2161787) 2161787..2161850 + 64 NuclAT_40 - -
- (2161787) 2161787..2161850 + 64 NuclAT_42 - -
- (2161787) 2161787..2161850 + 64 NuclAT_42 - -
- (2161787) 2161787..2161850 + 64 NuclAT_42 - -
- (2161787) 2161787..2161850 + 64 NuclAT_42 - -
- (2161785) 2161785..2161851 + 67 NuclAT_27 - -
- (2161785) 2161785..2161851 + 67 NuclAT_27 - -
- (2161785) 2161785..2161851 + 67 NuclAT_27 - -
- (2161785) 2161785..2161851 + 67 NuclAT_27 - -
- (2161785) 2161785..2161851 + 67 NuclAT_29 - -
- (2161785) 2161785..2161851 + 67 NuclAT_29 - -
- (2161785) 2161785..2161851 + 67 NuclAT_29 - -
- (2161785) 2161785..2161851 + 67 NuclAT_29 - -
- (2161785) 2161785..2161851 + 67 NuclAT_31 - -
- (2161785) 2161785..2161851 + 67 NuclAT_31 - -
- (2161785) 2161785..2161851 + 67 NuclAT_31 - -
- (2161785) 2161785..2161851 + 67 NuclAT_31 - -
- (2161785) 2161785..2161851 + 67 NuclAT_33 - -
- (2161785) 2161785..2161851 + 67 NuclAT_33 - -
- (2161785) 2161785..2161851 + 67 NuclAT_33 - -
- (2161785) 2161785..2161851 + 67 NuclAT_33 - -
- (2161785) 2161785..2161851 + 67 NuclAT_35 - -
- (2161785) 2161785..2161851 + 67 NuclAT_35 - -
- (2161785) 2161785..2161851 + 67 NuclAT_35 - -
- (2161785) 2161785..2161851 + 67 NuclAT_35 - -
- (2161785) 2161785..2161851 + 67 NuclAT_37 - -
- (2161785) 2161785..2161851 + 67 NuclAT_37 - -
- (2161785) 2161785..2161851 + 67 NuclAT_37 - -
- (2161785) 2161785..2161851 + 67 NuclAT_37 - -
PHA55_RS10465 (2162165) 2162165..2162272 - 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- (2162325) 2162325..2162386 + 62 NuclAT_39 - -
- (2162325) 2162325..2162386 + 62 NuclAT_39 - -
- (2162325) 2162325..2162386 + 62 NuclAT_39 - -
- (2162325) 2162325..2162386 + 62 NuclAT_39 - -
- (2162325) 2162325..2162386 + 62 NuclAT_41 - -
- (2162325) 2162325..2162386 + 62 NuclAT_41 - -
- (2162325) 2162325..2162386 + 62 NuclAT_41 - -
- (2162325) 2162325..2162386 + 62 NuclAT_41 - -
- (2162325) 2162325..2162387 + 63 NuclAT_28 - -
- (2162325) 2162325..2162387 + 63 NuclAT_28 - -
- (2162325) 2162325..2162387 + 63 NuclAT_28 - -
- (2162325) 2162325..2162387 + 63 NuclAT_28 - -
- (2162325) 2162325..2162387 + 63 NuclAT_30 - -
- (2162325) 2162325..2162387 + 63 NuclAT_30 - -
- (2162325) 2162325..2162387 + 63 NuclAT_30 - -
- (2162325) 2162325..2162387 + 63 NuclAT_30 - -
- (2162325) 2162325..2162387 + 63 NuclAT_32 - -
- (2162325) 2162325..2162387 + 63 NuclAT_32 - -
- (2162325) 2162325..2162387 + 63 NuclAT_32 - -
- (2162325) 2162325..2162387 + 63 NuclAT_32 - -
- (2162325) 2162325..2162387 + 63 NuclAT_34 - -
- (2162325) 2162325..2162387 + 63 NuclAT_34 - -
- (2162325) 2162325..2162387 + 63 NuclAT_34 - -
- (2162325) 2162325..2162387 + 63 NuclAT_34 - -
- (2162325) 2162325..2162387 + 63 NuclAT_36 - -
- (2162325) 2162325..2162387 + 63 NuclAT_36 - -
- (2162325) 2162325..2162387 + 63 NuclAT_36 - -
- (2162325) 2162325..2162387 + 63 NuclAT_36 - -
- (2162325) 2162325..2162387 + 63 NuclAT_38 - -
- (2162325) 2162325..2162387 + 63 NuclAT_38 - -
- (2162325) 2162325..2162387 + 63 NuclAT_38 - -
- (2162325) 2162325..2162387 + 63 NuclAT_38 - -
- (2162325) 2162325..2162388 + 64 NuclAT_16 - -
- (2162325) 2162325..2162388 + 64 NuclAT_16 - -
- (2162325) 2162325..2162388 + 64 NuclAT_16 - -
- (2162325) 2162325..2162388 + 64 NuclAT_16 - -
- (2162325) 2162325..2162388 + 64 NuclAT_18 - -
- (2162325) 2162325..2162388 + 64 NuclAT_18 - -
- (2162325) 2162325..2162388 + 64 NuclAT_18 - -
- (2162325) 2162325..2162388 + 64 NuclAT_18 - -
- (2162325) 2162325..2162388 + 64 NuclAT_20 - -
- (2162325) 2162325..2162388 + 64 NuclAT_20 - -
- (2162325) 2162325..2162388 + 64 NuclAT_20 - -
- (2162325) 2162325..2162388 + 64 NuclAT_20 - -
- (2162325) 2162325..2162388 + 64 NuclAT_22 - -
- (2162325) 2162325..2162388 + 64 NuclAT_22 - -
- (2162325) 2162325..2162388 + 64 NuclAT_22 - -
- (2162325) 2162325..2162388 + 64 NuclAT_22 - -
- (2162325) 2162325..2162388 + 64 NuclAT_24 - -
- (2162325) 2162325..2162388 + 64 NuclAT_24 - -
- (2162325) 2162325..2162388 + 64 NuclAT_24 - -
- (2162325) 2162325..2162388 + 64 NuclAT_24 - -
- (2162325) 2162325..2162388 + 64 NuclAT_26 - -
- (2162325) 2162325..2162388 + 64 NuclAT_26 - -
- (2162325) 2162325..2162388 + 64 NuclAT_26 - -
- (2162325) 2162325..2162388 + 64 NuclAT_26 - -
PHA55_RS10470 (2162701) 2162701..2162808 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (2162856) 2162856..2162923 + 68 NuclAT_15 - Antitoxin
- (2162856) 2162856..2162923 + 68 NuclAT_15 - Antitoxin
- (2162856) 2162856..2162923 + 68 NuclAT_15 - Antitoxin
- (2162856) 2162856..2162923 + 68 NuclAT_15 - Antitoxin
- (2162856) 2162856..2162923 + 68 NuclAT_17 - Antitoxin
- (2162856) 2162856..2162923 + 68 NuclAT_17 - Antitoxin
- (2162856) 2162856..2162923 + 68 NuclAT_17 - Antitoxin
- (2162856) 2162856..2162923 + 68 NuclAT_17 - Antitoxin
- (2162856) 2162856..2162923 + 68 NuclAT_19 - Antitoxin
- (2162856) 2162856..2162923 + 68 NuclAT_19 - Antitoxin
- (2162856) 2162856..2162923 + 68 NuclAT_19 - Antitoxin
- (2162856) 2162856..2162923 + 68 NuclAT_19 - Antitoxin
- (2162856) 2162856..2162923 + 68 NuclAT_21 - Antitoxin
- (2162856) 2162856..2162923 + 68 NuclAT_21 - Antitoxin
- (2162856) 2162856..2162923 + 68 NuclAT_21 - Antitoxin
- (2162856) 2162856..2162923 + 68 NuclAT_21 - Antitoxin
- (2162856) 2162856..2162923 + 68 NuclAT_23 - Antitoxin
- (2162856) 2162856..2162923 + 68 NuclAT_23 - Antitoxin
- (2162856) 2162856..2162923 + 68 NuclAT_23 - Antitoxin
- (2162856) 2162856..2162923 + 68 NuclAT_23 - Antitoxin
- (2162856) 2162856..2162923 + 68 NuclAT_25 - Antitoxin
- (2162856) 2162856..2162923 + 68 NuclAT_25 - Antitoxin
- (2162856) 2162856..2162923 + 68 NuclAT_25 - Antitoxin
- (2162856) 2162856..2162923 + 68 NuclAT_25 - Antitoxin
PHA55_RS10475 (2163213) 2163213..2164313 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
PHA55_RS10480 (2164583) 2164583..2164813 + 231 WP_001146442.1 putative cation transport regulator ChaB -
PHA55_RS10485 (2164971) 2164971..2165666 + 696 WP_001355927.1 glutathione-specific gamma-glutamylcyclotransferase -
PHA55_RS10490 (2165710) 2165710..2166063 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
PHA55_RS10495 (2166248) 2166248..2167642 + 1395 WP_000086213.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T267702 WP_000170965.1 NZ_CP116044:c2162808-2162701 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

Antitoxin


Download         Length: 68 bp

>AT267702 NZ_CP116044:2162856-2162923 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References