Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 2161630..2161851 | Replicon | chromosome |
| Accession | NZ_CP116044 | ||
| Organism | Escherichia coli strain STEC1575 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | - |
| Locus tag | PHA55_RS10460 | Protein ID | WP_176258838.1 |
| Coordinates | 2161630..2161737 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 2161785..2161851 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PHA55_RS10435 (2157474) | 2157474..2158556 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
| PHA55_RS10440 (2158556) | 2158556..2159389 | + | 834 | WP_000456571.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| PHA55_RS10445 (2159386) | 2159386..2159778 | + | 393 | WP_000200392.1 | invasion regulator SirB2 | - |
| PHA55_RS10450 (2159782) | 2159782..2160591 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| PHA55_RS10455 (2160627) | 2160627..2161481 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| PHA55_RS10460 (2161630) | 2161630..2161737 | - | 108 | WP_176258838.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - (2161787) | 2161787..2161850 | + | 64 | NuclAT_40 | - | - |
| - (2161787) | 2161787..2161850 | + | 64 | NuclAT_40 | - | - |
| - (2161787) | 2161787..2161850 | + | 64 | NuclAT_40 | - | - |
| - (2161787) | 2161787..2161850 | + | 64 | NuclAT_40 | - | - |
| - (2161787) | 2161787..2161850 | + | 64 | NuclAT_42 | - | - |
| - (2161787) | 2161787..2161850 | + | 64 | NuclAT_42 | - | - |
| - (2161787) | 2161787..2161850 | + | 64 | NuclAT_42 | - | - |
| - (2161787) | 2161787..2161850 | + | 64 | NuclAT_42 | - | - |
| - (2161785) | 2161785..2161851 | + | 67 | NuclAT_27 | - | Antitoxin |
| - (2161785) | 2161785..2161851 | + | 67 | NuclAT_27 | - | Antitoxin |
| - (2161785) | 2161785..2161851 | + | 67 | NuclAT_27 | - | Antitoxin |
| - (2161785) | 2161785..2161851 | + | 67 | NuclAT_27 | - | Antitoxin |
| - (2161785) | 2161785..2161851 | + | 67 | NuclAT_29 | - | Antitoxin |
| - (2161785) | 2161785..2161851 | + | 67 | NuclAT_29 | - | Antitoxin |
| - (2161785) | 2161785..2161851 | + | 67 | NuclAT_29 | - | Antitoxin |
| - (2161785) | 2161785..2161851 | + | 67 | NuclAT_29 | - | Antitoxin |
| - (2161785) | 2161785..2161851 | + | 67 | NuclAT_31 | - | Antitoxin |
| - (2161785) | 2161785..2161851 | + | 67 | NuclAT_31 | - | Antitoxin |
| - (2161785) | 2161785..2161851 | + | 67 | NuclAT_31 | - | Antitoxin |
| - (2161785) | 2161785..2161851 | + | 67 | NuclAT_31 | - | Antitoxin |
| - (2161785) | 2161785..2161851 | + | 67 | NuclAT_33 | - | Antitoxin |
| - (2161785) | 2161785..2161851 | + | 67 | NuclAT_33 | - | Antitoxin |
| - (2161785) | 2161785..2161851 | + | 67 | NuclAT_33 | - | Antitoxin |
| - (2161785) | 2161785..2161851 | + | 67 | NuclAT_33 | - | Antitoxin |
| - (2161785) | 2161785..2161851 | + | 67 | NuclAT_35 | - | Antitoxin |
| - (2161785) | 2161785..2161851 | + | 67 | NuclAT_35 | - | Antitoxin |
| - (2161785) | 2161785..2161851 | + | 67 | NuclAT_35 | - | Antitoxin |
| - (2161785) | 2161785..2161851 | + | 67 | NuclAT_35 | - | Antitoxin |
| - (2161785) | 2161785..2161851 | + | 67 | NuclAT_37 | - | Antitoxin |
| - (2161785) | 2161785..2161851 | + | 67 | NuclAT_37 | - | Antitoxin |
| - (2161785) | 2161785..2161851 | + | 67 | NuclAT_37 | - | Antitoxin |
| - (2161785) | 2161785..2161851 | + | 67 | NuclAT_37 | - | Antitoxin |
| PHA55_RS10465 (2162165) | 2162165..2162272 | - | 108 | WP_000170926.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - (2162325) | 2162325..2162386 | + | 62 | NuclAT_39 | - | - |
| - (2162325) | 2162325..2162386 | + | 62 | NuclAT_39 | - | - |
| - (2162325) | 2162325..2162386 | + | 62 | NuclAT_39 | - | - |
| - (2162325) | 2162325..2162386 | + | 62 | NuclAT_39 | - | - |
| - (2162325) | 2162325..2162386 | + | 62 | NuclAT_41 | - | - |
| - (2162325) | 2162325..2162386 | + | 62 | NuclAT_41 | - | - |
| - (2162325) | 2162325..2162386 | + | 62 | NuclAT_41 | - | - |
| - (2162325) | 2162325..2162386 | + | 62 | NuclAT_41 | - | - |
| - (2162325) | 2162325..2162387 | + | 63 | NuclAT_28 | - | - |
| - (2162325) | 2162325..2162387 | + | 63 | NuclAT_28 | - | - |
| - (2162325) | 2162325..2162387 | + | 63 | NuclAT_28 | - | - |
| - (2162325) | 2162325..2162387 | + | 63 | NuclAT_28 | - | - |
| - (2162325) | 2162325..2162387 | + | 63 | NuclAT_30 | - | - |
| - (2162325) | 2162325..2162387 | + | 63 | NuclAT_30 | - | - |
| - (2162325) | 2162325..2162387 | + | 63 | NuclAT_30 | - | - |
| - (2162325) | 2162325..2162387 | + | 63 | NuclAT_30 | - | - |
| - (2162325) | 2162325..2162387 | + | 63 | NuclAT_32 | - | - |
| - (2162325) | 2162325..2162387 | + | 63 | NuclAT_32 | - | - |
| - (2162325) | 2162325..2162387 | + | 63 | NuclAT_32 | - | - |
| - (2162325) | 2162325..2162387 | + | 63 | NuclAT_32 | - | - |
| - (2162325) | 2162325..2162387 | + | 63 | NuclAT_34 | - | - |
| - (2162325) | 2162325..2162387 | + | 63 | NuclAT_34 | - | - |
| - (2162325) | 2162325..2162387 | + | 63 | NuclAT_34 | - | - |
| - (2162325) | 2162325..2162387 | + | 63 | NuclAT_34 | - | - |
| - (2162325) | 2162325..2162387 | + | 63 | NuclAT_36 | - | - |
| - (2162325) | 2162325..2162387 | + | 63 | NuclAT_36 | - | - |
| - (2162325) | 2162325..2162387 | + | 63 | NuclAT_36 | - | - |
| - (2162325) | 2162325..2162387 | + | 63 | NuclAT_36 | - | - |
| - (2162325) | 2162325..2162387 | + | 63 | NuclAT_38 | - | - |
| - (2162325) | 2162325..2162387 | + | 63 | NuclAT_38 | - | - |
| - (2162325) | 2162325..2162387 | + | 63 | NuclAT_38 | - | - |
| - (2162325) | 2162325..2162387 | + | 63 | NuclAT_38 | - | - |
| - (2162325) | 2162325..2162388 | + | 64 | NuclAT_16 | - | - |
| - (2162325) | 2162325..2162388 | + | 64 | NuclAT_16 | - | - |
| - (2162325) | 2162325..2162388 | + | 64 | NuclAT_16 | - | - |
| - (2162325) | 2162325..2162388 | + | 64 | NuclAT_16 | - | - |
| - (2162325) | 2162325..2162388 | + | 64 | NuclAT_18 | - | - |
| - (2162325) | 2162325..2162388 | + | 64 | NuclAT_18 | - | - |
| - (2162325) | 2162325..2162388 | + | 64 | NuclAT_18 | - | - |
| - (2162325) | 2162325..2162388 | + | 64 | NuclAT_18 | - | - |
| - (2162325) | 2162325..2162388 | + | 64 | NuclAT_20 | - | - |
| - (2162325) | 2162325..2162388 | + | 64 | NuclAT_20 | - | - |
| - (2162325) | 2162325..2162388 | + | 64 | NuclAT_20 | - | - |
| - (2162325) | 2162325..2162388 | + | 64 | NuclAT_20 | - | - |
| - (2162325) | 2162325..2162388 | + | 64 | NuclAT_22 | - | - |
| - (2162325) | 2162325..2162388 | + | 64 | NuclAT_22 | - | - |
| - (2162325) | 2162325..2162388 | + | 64 | NuclAT_22 | - | - |
| - (2162325) | 2162325..2162388 | + | 64 | NuclAT_22 | - | - |
| - (2162325) | 2162325..2162388 | + | 64 | NuclAT_24 | - | - |
| - (2162325) | 2162325..2162388 | + | 64 | NuclAT_24 | - | - |
| - (2162325) | 2162325..2162388 | + | 64 | NuclAT_24 | - | - |
| - (2162325) | 2162325..2162388 | + | 64 | NuclAT_24 | - | - |
| - (2162325) | 2162325..2162388 | + | 64 | NuclAT_26 | - | - |
| - (2162325) | 2162325..2162388 | + | 64 | NuclAT_26 | - | - |
| - (2162325) | 2162325..2162388 | + | 64 | NuclAT_26 | - | - |
| - (2162325) | 2162325..2162388 | + | 64 | NuclAT_26 | - | - |
| PHA55_RS10470 (2162701) | 2162701..2162808 | - | 108 | WP_000170965.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - (2162856) | 2162856..2162923 | + | 68 | NuclAT_15 | - | - |
| - (2162856) | 2162856..2162923 | + | 68 | NuclAT_15 | - | - |
| - (2162856) | 2162856..2162923 | + | 68 | NuclAT_15 | - | - |
| - (2162856) | 2162856..2162923 | + | 68 | NuclAT_15 | - | - |
| - (2162856) | 2162856..2162923 | + | 68 | NuclAT_17 | - | - |
| - (2162856) | 2162856..2162923 | + | 68 | NuclAT_17 | - | - |
| - (2162856) | 2162856..2162923 | + | 68 | NuclAT_17 | - | - |
| - (2162856) | 2162856..2162923 | + | 68 | NuclAT_17 | - | - |
| - (2162856) | 2162856..2162923 | + | 68 | NuclAT_19 | - | - |
| - (2162856) | 2162856..2162923 | + | 68 | NuclAT_19 | - | - |
| - (2162856) | 2162856..2162923 | + | 68 | NuclAT_19 | - | - |
| - (2162856) | 2162856..2162923 | + | 68 | NuclAT_19 | - | - |
| - (2162856) | 2162856..2162923 | + | 68 | NuclAT_21 | - | - |
| - (2162856) | 2162856..2162923 | + | 68 | NuclAT_21 | - | - |
| - (2162856) | 2162856..2162923 | + | 68 | NuclAT_21 | - | - |
| - (2162856) | 2162856..2162923 | + | 68 | NuclAT_21 | - | - |
| - (2162856) | 2162856..2162923 | + | 68 | NuclAT_23 | - | - |
| - (2162856) | 2162856..2162923 | + | 68 | NuclAT_23 | - | - |
| - (2162856) | 2162856..2162923 | + | 68 | NuclAT_23 | - | - |
| - (2162856) | 2162856..2162923 | + | 68 | NuclAT_23 | - | - |
| - (2162856) | 2162856..2162923 | + | 68 | NuclAT_25 | - | - |
| - (2162856) | 2162856..2162923 | + | 68 | NuclAT_25 | - | - |
| - (2162856) | 2162856..2162923 | + | 68 | NuclAT_25 | - | - |
| - (2162856) | 2162856..2162923 | + | 68 | NuclAT_25 | - | - |
| PHA55_RS10475 (2163213) | 2163213..2164313 | - | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
| PHA55_RS10480 (2164583) | 2164583..2164813 | + | 231 | WP_001146442.1 | putative cation transport regulator ChaB | - |
| PHA55_RS10485 (2164971) | 2164971..2165666 | + | 696 | WP_001355927.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| PHA55_RS10490 (2165710) | 2165710..2166063 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4013.82 Da Isoelectric Point: 11.4779
>T267701 WP_176258838.1 NZ_CP116044:c2161737-2161630 [Escherichia coli]
MTLAQFAMIFWHDLTAPILAGIITAAIVGWWRNRK
MTLAQFAMIFWHDLTAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
Antitoxin
Download Length: 67 bp
>AT267701 NZ_CP116044:2161785-2161851 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCTC
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|