Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 197312..197914 | Replicon | chromosome |
| Accession | NZ_CP116044 | ||
| Organism | Escherichia coli strain STEC1575 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9XIS6 |
| Locus tag | PHA55_RS00965 | Protein ID | WP_000897305.1 |
| Coordinates | 197312..197623 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PHA55_RS00970 | Protein ID | WP_000356397.1 |
| Coordinates | 197624..197914 (+) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PHA55_RS00940 (193226) | 193226..193825 | + | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
| PHA55_RS00945 (193819) | 193819..194691 | + | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| PHA55_RS00950 (194688) | 194688..195125 | + | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
| PHA55_RS00955 (195170) | 195170..196111 | + | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| PHA55_RS00960 (196175) | 196175..197083 | - | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
| PHA55_RS00965 (197312) | 197312..197623 | + | 312 | WP_000897305.1 | hypothetical protein | Toxin |
| PHA55_RS00970 (197624) | 197624..197914 | + | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| PHA55_RS00975 (198500) | 198500..198718 | + | 219 | WP_001315930.1 | CopG family transcriptional regulator | - |
| PHA55_RS00980 (198938) | 198938..199180 | + | 243 | WP_001087409.1 | protein YiiF | - |
| PHA55_RS00985 (199510) | 199510..200439 | - | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
| PHA55_RS00990 (200436) | 200436..201071 | - | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
| PHA55_RS00995 (201068) | 201068..201970 | - | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T267695 WP_000897305.1 NZ_CP116044:197312-197623 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|