Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
| Location | 3179849..3180434 | Replicon | chromosome |
| Accession | NZ_CP116040 | ||
| Organism | Acinetobacter haemolyticus strain HW-2 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | PGW89_RS14655 | Protein ID | WP_113997133.1 |
| Coordinates | 3180114..3180434 (-) | Length | 107 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PGW89_RS14650 | Protein ID | WP_005082538.1 |
| Coordinates | 3179849..3180121 (-) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PGW89_RS14630 (PGW89_14630) | 3175871..3176371 | + | 501 | WP_113997971.1 | 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase | - |
| PGW89_RS14635 (PGW89_14635) | 3176371..3176706 | + | 336 | WP_005082534.1 | hydroxyisourate hydrolase | - |
| PGW89_RS14640 (PGW89_14640) | 3176754..3178130 | + | 1377 | WP_113997131.1 | nucleobase:cation symporter-2 family protein | - |
| PGW89_RS14645 (PGW89_14645) | 3178313..3179608 | + | 1296 | WP_113997132.1 | hypothetical protein | - |
| PGW89_RS14650 (PGW89_14650) | 3179849..3180121 | - | 273 | WP_005082538.1 | NadS family protein | Antitoxin |
| PGW89_RS14655 (PGW89_14655) | 3180114..3180434 | - | 321 | WP_113997133.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PGW89_RS14660 (PGW89_14660) | 3180618..3181775 | - | 1158 | WP_113997134.1 | FAD-dependent urate hydroxylase HpxO | - |
| PGW89_RS14665 (PGW89_14665) | 3181957..3182667 | - | 711 | WP_005082543.1 | FadR/GntR family transcriptional regulator | - |
| PGW89_RS14670 (PGW89_14670) | 3182834..3183838 | + | 1005 | WP_113997135.1 | allantoicase | - |
| PGW89_RS14675 (PGW89_14675) | 3184084..3184587 | + | 504 | WP_113997136.1 | ureidoglycolate lyase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 12167.13 Da Isoelectric Point: 7.8145
>T267675 WP_113997133.1 NZ_CP116040:c3180434-3180114 [Acinetobacter haemolyticus]
MLFIETSIFTKQIKELISDDEYRELQQELLVQPDKGDLIKNGGGIRKVRCAQGSKGKSGGIRVIYYWITKDDQIFMLLAY
PKSVKENLTEKETAILCQLVKEQFHG
MLFIETSIFTKQIKELISDDEYRELQQELLVQPDKGDLIKNGGGIRKVRCAQGSKGKSGGIRVIYYWITKDDQIFMLLAY
PKSVKENLTEKETAILCQLVKEQFHG
Download Length: 321 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|