Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 2436..2700 Replicon plasmid unnamed1
Accession NZ_CP116036
Organism Escherichia coli strain FAH

Toxin (Protein)


Gene name pndA Uniprot ID U9Y6M3
Locus tag PGH49_RS24985 Protein ID WP_001331364.1
Coordinates 2436..2588 (-) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 2638..2700 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PGH49_RS24960 (1) 1..663 + 663 WP_012783935.1 plasmid IncI1-type surface exclusion protein ExcA -
PGH49_RS24965 (735) 735..944 - 210 WP_000062602.1 HEAT repeat domain-containing protein -
PGH49_RS24970 (1276) 1276..1452 + 177 WP_001054900.1 hypothetical protein -
PGH49_RS24975 (1517) 1517..1612 - 96 WP_000609148.1 DinQ-like type I toxin DqlB -
PGH49_RS24980 (2113) 2113..2364 + 252 WP_001291964.1 hypothetical protein -
PGH49_RS24985 (2436) 2436..2588 - 153 WP_001331364.1 Hok/Gef family protein Toxin
- (2638) 2638..2700 + 63 NuclAT_0 - Antitoxin
- (2638) 2638..2700 + 63 NuclAT_0 - Antitoxin
- (2638) 2638..2700 + 63 NuclAT_0 - Antitoxin
- (2638) 2638..2700 + 63 NuclAT_0 - Antitoxin
- (2941) 2941..2996 + 56 NuclAT_1 - -
- (2941) 2941..2996 + 56 NuclAT_1 - -
- (2941) 2941..2996 + 56 NuclAT_1 - -
- (2941) 2941..2996 + 56 NuclAT_1 - -
PGH49_RS24990 (3190) 3190..4143 + 954 WP_021513958.1 hypothetical protein -
PGH49_RS24995 (4361) 4361..5569 + 1209 WP_001383960.1 IncI1-type conjugal transfer protein TrbA -
PGH49_RS25000 (5588) 5588..6658 + 1071 WP_000151583.1 IncI1-type conjugal transfer protein TrbB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..82920 82920


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5775.13 Da        Isoelectric Point: 8.7948

>T267665 WP_001331364.1 NZ_CP116036:c2588-2436 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 63 bp

>AT267665 NZ_CP116036:2638-2700 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5W9M382

Antitoxin

Download structure file

References