Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4838530..4839132 | Replicon | chromosome |
| Accession | NZ_CP116035 | ||
| Organism | Escherichia coli strain FAH | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1P416 |
| Locus tag | PGH49_RS23890 | Protein ID | WP_000897302.1 |
| Coordinates | 4838821..4839132 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PGH49_RS23885 | Protein ID | WP_000356397.1 |
| Coordinates | 4838530..4838820 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PGH49_RS23860 (4834603) | 4834603..4835505 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
| PGH49_RS23865 (4835502) | 4835502..4836137 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
| PGH49_RS23870 (4836134) | 4836134..4837063 | + | 930 | WP_000027720.1 | formate dehydrogenase accessory protein FdhE | - |
| PGH49_RS23875 (4837279) | 4837279..4837497 | - | 219 | WP_001314326.1 | CopG family transcriptional regulator | - |
| PGH49_RS23880 (4837893) | 4837893..4838171 | - | 279 | WP_001296612.1 | hypothetical protein | - |
| PGH49_RS23885 (4838530) | 4838530..4838820 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| PGH49_RS23890 (4838821) | 4838821..4839132 | - | 312 | WP_000897302.1 | hypothetical protein | Toxin |
| PGH49_RS23895 (4839361) | 4839361..4840269 | + | 909 | WP_001774092.1 | alpha/beta hydrolase | - |
| PGH49_RS23900 (4840333) | 4840333..4841274 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| PGH49_RS23905 (4841319) | 4841319..4841756 | - | 438 | WP_000560978.1 | D-aminoacyl-tRNA deacylase | - |
| PGH49_RS23910 (4841753) | 4841753..4842625 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| PGH49_RS23915 (4842619) | 4842619..4843218 | - | 600 | WP_001314324.1 | glucose-1-phosphatase | - |
| PGH49_RS23920 (4843317) | 4843317..4844102 | - | 786 | WP_000059678.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T267664 WP_000897302.1 NZ_CP116035:c4839132-4838821 [Escherichia coli]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|