Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 3807321..3808015 | Replicon | chromosome |
| Accession | NZ_CP116035 | ||
| Organism | Escherichia coli strain FAH | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | S1PJQ2 |
| Locus tag | PGH49_RS18895 | Protein ID | WP_001263500.1 |
| Coordinates | 3807321..3807719 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1QAE3 |
| Locus tag | PGH49_RS18900 | Protein ID | WP_000554758.1 |
| Coordinates | 3807722..3808015 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PGH49_RS18870 (3802686) | 3802686..3803144 | - | 459 | WP_001291991.1 | xanthine phosphoribosyltransferase | - |
| PGH49_RS18875 (3803405) | 3803405..3804862 | + | 1458 | WP_001292999.1 | cytosol nonspecific dipeptidase | - |
| PGH49_RS18880 (3804919) | 3804919..3805533 | - | 615 | WP_000602124.1 | peptide chain release factor H | - |
| PGH49_RS18885 (3805530) | 3805530..3806669 | - | 1140 | WP_000521561.1 | RNA ligase RtcB family protein | - |
| PGH49_RS18890 (3806859) | 3806859..3807311 | - | 453 | WP_001059895.1 | GNAT family N-acetyltransferase | - |
| PGH49_RS18895 (3807321) | 3807321..3807719 | - | 399 | WP_001263500.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| PGH49_RS18900 (3807722) | 3807722..3808015 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| PGH49_RS18905 (3808067) | 3808067..3809122 | - | 1056 | WP_001226168.1 | DNA polymerase IV | - |
| PGH49_RS18910 (3809193) | 3809193..3810116 | - | 924 | WP_001532973.1 | putative lateral flagellar export/assembly protein LafU | - |
| PGH49_RS18915 (3810119) | 3810119..3810982 | - | 864 | WP_001169518.1 | flagellar motor stator protein MotA | - |
| PGH49_RS18920 (3810995) | 3810995..3811711 | - | 717 | WP_000938731.1 | FliA/WhiG family RNA polymerase sigma factor | - |
| PGH49_RS18925 (3811731) | 3811731..3812198 | - | 468 | WP_000725261.1 | flagellar basal body-associated FliL family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15413.85 Da Isoelectric Point: 8.9511
>T267654 WP_001263500.1 NZ_CP116035:c3807719-3807321 [Escherichia coli]
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|