Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
Location | 3579582..3580261 | Replicon | chromosome |
Accession | NZ_CP116035 | ||
Organism | Escherichia coli strain FAH |
Toxin (Protein)
Gene name | higB | Uniprot ID | S1PK60 |
Locus tag | PGH49_RS17845 | Protein ID | WP_000057523.1 |
Coordinates | 3579959..3580261 (-) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | S1QAY3 |
Locus tag | PGH49_RS17840 | Protein ID | WP_000806442.1 |
Coordinates | 3579582..3579923 (-) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PGH49_RS17830 (3575826) | 3575826..3576758 | - | 933 | WP_001538399.1 | glutaminase A | - |
PGH49_RS17835 (3577020) | 3577020..3579524 | + | 2505 | WP_000083948.1 | copper-exporting P-type ATPase CopA | - |
PGH49_RS17840 (3579582) | 3579582..3579923 | - | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
PGH49_RS17845 (3579959) | 3579959..3580261 | - | 303 | WP_000057523.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PGH49_RS17850 (3580394) | 3580394..3581188 | + | 795 | WP_001538398.1 | TraB/GumN family protein | - |
PGH49_RS17855 (3581392) | 3581392..3581871 | + | 480 | WP_001538397.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
PGH49_RS17860 (3581908) | 3581908..3583560 | - | 1653 | WP_001773867.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
PGH49_RS17865 (3583778) | 3583778..3584998 | + | 1221 | WP_001773866.1 | fosmidomycin MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11809.44 Da Isoelectric Point: 10.3980
>T267652 WP_000057523.1 NZ_CP116035:c3580261-3579959 [Escherichia coli]
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|