Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | yonT-SR6/- |
Location | 2373624..2373953 | Replicon | chromosome |
Accession | NZ_CP116012 | ||
Organism | Bacillus subtilis strain SRCM124333 |
Toxin (Protein)
Gene name | yonT | Uniprot ID | A0A8E0VV64 |
Locus tag | PF977_RS12815 | Protein ID | WP_074794695.1 |
Coordinates | 2373624..2373875 (-) | Length | 84 a.a. |
Antitoxin (RNA)
Gene name | SR6 | ||
Locus tag | - | ||
Coordinates | 2373853..2373953 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PF977_RS12755 | 2368662..2368895 | - | 234 | WP_213418978.1 | hypothetical protein | - |
PF977_RS12760 | 2368968..2369189 | - | 222 | WP_213418992.1 | helix-turn-helix transcriptional regulator | - |
PF977_RS12765 | 2369256..2369588 | - | 333 | WP_019712280.1 | hypothetical protein | - |
PF977_RS12770 | 2369658..2369855 | - | 198 | WP_032677195.1 | hypothetical protein | - |
PF977_RS12775 | 2369958..2370284 | - | 327 | WP_271259403.1 | hypothetical protein | - |
PF977_RS12780 | 2370503..2370739 | - | 237 | WP_003230991.1 | hypothetical protein | - |
PF977_RS12785 | 2370762..2370935 | - | 174 | WP_015968356.1 | hypothetical protein | - |
PF977_RS12790 | 2370932..2371147 | - | 216 | WP_032677193.1 | hypothetical protein | - |
PF977_RS12795 | 2371180..2371461 | - | 282 | WP_050496376.1 | hypothetical protein | - |
PF977_RS12800 | 2371495..2371764 | - | 270 | WP_006640590.1 | hypothetical protein | - |
PF977_RS12805 | 2372092..2373309 | - | 1218 | WP_032721658.1 | hypothetical protein | - |
PF977_RS12810 | 2373391..2373579 | - | 189 | WP_032721656.1 | hypothetical protein | - |
PF977_RS12815 | 2373624..2373875 | - | 252 | WP_074794695.1 | hypothetical protein | Toxin |
- | 2373853..2373953 | + | 101 | - | - | Antitoxin |
PF977_RS12820 | 2373894..2374070 | - | 177 | WP_032721653.1 | hypothetical protein | - |
- | 2374011..2374111 | + | 101 | NuclAT_0 | - | - |
- | 2374011..2374111 | + | 101 | NuclAT_0 | - | - |
- | 2374011..2374111 | + | 101 | NuclAT_0 | - | - |
- | 2374011..2374111 | + | 101 | NuclAT_0 | - | - |
PF977_RS12825 | 2374611..2375222 | - | 612 | WP_074794693.1 | hypothetical protein | - |
PF977_RS12830 | 2375423..2375752 | - | 330 | WP_032721651.1 | helix-turn-helix transcriptional regulator | - |
PF977_RS12835 | 2376704..2376898 | + | 195 | WP_032721649.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2243664..2450695 | 207031 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 84 a.a. Molecular weight: 10099.18 Da Isoelectric Point: 10.0301
>T267619 WP_074794695.1 NZ_CP116012:c2373875-2373624 [Bacillus subtilis]
MNFSFSSYPYYNMIKHIVNMKRFSLWFTHITFIGLFLMFQLIKDYFSSEAQTLINIIFIVTCIIAILLWIIYFVFLKLRN
KSH
MNFSFSSYPYYNMIKHIVNMKRFSLWFTHITFIGLFLMFQLIKDYFSSEAQTLINIIFIVTCIIAILLWIIYFVFLKLRN
KSH
Download Length: 252 bp
Antitoxin
Download Length: 101 bp
>AT267619 NZ_CP116012:2373853-2373953 [Bacillus subtilis]
TAGGAACTAAAGGAGAAGTTCATTCCCCTTTAGCTTAGCTCTCATCGGCGTATACGTTGGCGTTGTCTCTTTGGTCGGAG
CCGCTTGCGTATACGCTTTTT
TAGGAACTAAAGGAGAAGTTCATTCCCCTTTAGCTTAGCTCTCATCGGCGTATACGTTGGCGTTGTCTCTTTGGTCGGAG
CCGCTTGCGTATACGCTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|