Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 1531363..1531954 | Replicon | chromosome |
Accession | NZ_CP116005 | ||
Organism | Sphingosinicella microcystinivorans strain DMF-3 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | PE061_RS07510 | Protein ID | WP_271258478.1 |
Coordinates | 1531679..1531954 (-) | Length | 92 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PE061_RS07505 | Protein ID | WP_271258477.1 |
Coordinates | 1531363..1531659 (-) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PE061_RS07480 (PE061_07480) | 1527013..1528230 | - | 1218 | WP_271258472.1 | acyl-CoA dehydrogenase family protein | - |
PE061_RS07485 (PE061_07485) | 1528243..1529337 | - | 1095 | WP_271258473.1 | acyl-CoA dehydrogenase family protein | - |
PE061_RS07490 (PE061_07490) | 1529414..1529611 | - | 198 | WP_271258474.1 | DUF1192 domain-containing protein | - |
PE061_RS07495 (PE061_07495) | 1529688..1530710 | + | 1023 | WP_271258475.1 | NAD(P)H-quinone oxidoreductase | - |
PE061_RS07500 (PE061_07500) | 1530688..1531308 | + | 621 | WP_271258476.1 | glutathione S-transferase family protein | - |
PE061_RS07505 (PE061_07505) | 1531363..1531659 | - | 297 | WP_271258477.1 | HigA family addiction module antitoxin | Antitoxin |
PE061_RS07510 (PE061_07510) | 1531679..1531954 | - | 276 | WP_271258478.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PE061_RS07515 (PE061_07515) | 1532160..1533011 | + | 852 | WP_271259151.1 | UDP-2,3-diacylglucosamine diphosphatase | - |
PE061_RS07520 (PE061_07520) | 1533061..1534080 | + | 1020 | WP_271258479.1 | glycosyltransferase family 1 protein | - |
PE061_RS07525 (PE061_07525) | 1534186..1534812 | + | 627 | WP_271259152.1 | DUF1013 domain-containing protein | - |
PE061_RS07530 (PE061_07530) | 1534864..1535982 | + | 1119 | WP_271258480.1 | MBL fold metallo-hydrolase | - |
PE061_RS07535 (PE061_07535) | 1535972..1536658 | + | 687 | WP_271258481.1 | HAD-IA family hydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10301.57 Da Isoelectric Point: 8.4495
>T267608 WP_271258478.1 NZ_CP116005:c1531954-1531679 [Sphingosinicella microcystinivorans]
MIRSYRSKPLRRFAEEGNASKLPVANTDRVRRILAALEAAVTPEEMNLPGYRFHGLQGKPRRYAVDASGNYRITFGFDGT
DAVDVDIEDYH
MIRSYRSKPLRRFAEEGNASKLPVANTDRVRRILAALEAAVTPEEMNLPGYRFHGLQGKPRRYAVDASGNYRITFGFDGT
DAVDVDIEDYH
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|