Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | fst-RNAII/- |
| Location | 2337117..2337311 | Replicon | chromosome |
| Accession | NZ_CP115992 | ||
| Organism | Enterococcus faecalis strain ESC1 | ||
Toxin (Protein)
| Gene name | fst | Uniprot ID | - |
| Locus tag | PE069_RS11290 | Protein ID | WP_015543884.1 |
| Coordinates | 2337216..2337311 (-) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | RNAII | ||
| Locus tag | - | ||
| Coordinates | 2337117..2337181 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PE069_RS11275 (2332744) | 2332744..2334492 | + | 1749 | WP_161975114.1 | PTS transporter subunit EIIC | - |
| PE069_RS11280 (2334483) | 2334483..2336516 | + | 2034 | WP_002355275.1 | BglG family transcription antiterminator | - |
| PE069_RS11285 (2336527) | 2336527..2336961 | + | 435 | WP_002358391.1 | PTS sugar transporter subunit IIA | - |
| - (2337117) | 2337117..2337181 | + | 65 | NuclAT_15 | - | Antitoxin |
| PE069_RS11290 (2337216) | 2337216..2337311 | - | 96 | WP_015543884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| PE069_RS11295 (2337557) | 2337557..2339329 | + | 1773 | WP_002405272.1 | PTS mannitol-specific transporter subunit IIBC | - |
| PE069_RS11300 (2339344) | 2339344..2339781 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
| PE069_RS11305 (2339796) | 2339796..2340950 | + | 1155 | WP_010775146.1 | mannitol-1-phosphate 5-dehydrogenase | - |
| PE069_RS11310 (2341017) | 2341017..2342132 | - | 1116 | WP_010707863.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3659.47 Da Isoelectric Point: 4.6275
>T267582 WP_015543884.1 NZ_CP115992:c2337311-2337216 [Enterococcus faecalis]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
Antitoxin
Download Length: 65 bp
>AT267582 NZ_CP115992:2337117-2337181 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|