Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-ratA/- |
| Location | 1891813..1892139 | Replicon | chromosome |
| Accession | NZ_CP115992 | ||
| Organism | Enterococcus faecalis strain ESC1 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | - |
| Locus tag | PE069_RS09060 | Protein ID | WP_116593266.1 |
| Coordinates | 1891999..1892139 (+) | Length | 47 a.a. |
Antitoxin (RNA)
| Gene name | ratA | ||
| Locus tag | - | ||
| Coordinates | 1891813..1891997 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PE069_RS09040 (1887485) | 1887485..1888084 | - | 600 | WP_225560887.1 | RloB family protein | - |
| PE069_RS09045 (1888093) | 1888093..1889388 | - | 1296 | WP_192177102.1 | ATP-binding protein | - |
| PE069_RS09050 (1889850) | 1889850..1891466 | + | 1617 | WP_002372620.1 | phosphatase PAP2/LCP family protein | - |
| PE069_RS09055 (1891698) | 1891698..1891880 | + | 183 | WP_271232318.1 | type I toxin-antitoxin system toxin PepG1 | - |
| - (1891813) | 1891813..1891997 | - | 185 | NuclAT_9 | - | Antitoxin |
| - (1891854) | 1891854..1891997 | - | 144 | NuclAT_12 | - | - |
| PE069_RS09060 (1891999) | 1891999..1892139 | + | 141 | WP_116593266.1 | putative holin-like toxin | Toxin |
| - (1892072) | 1892072..1892331 | - | 260 | NuclAT_8 | - | - |
| - (1892283) | 1892283..1892332 | + | 50 | NuclAT_14 | - | - |
| - (1892113) | 1892113..1892333 | - | 221 | NuclAT_11 | - | - |
| PE069_RS09065 (1892334) | 1892334..1895333 | - | 3000 | WP_271232319.1 | WxL domain-containing protein | - |
| PE069_RS09070 (1895314) | 1895314..1895682 | - | 369 | WP_096398072.1 | LPXTG cell wall anchor domain-containing protein | - |
| PE069_RS09075 (1896068) | 1896068..1897015 | - | 948 | WP_002367506.1 | 1,4-dihydroxy-2-naphthoate polyprenyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 47 a.a. Molecular weight: 5204.26 Da Isoelectric Point: 10.1092
>T267577 WP_116593266.1 NZ_CP115992:1891999-1892139 [Enterococcus faecalis]
ISLKNTNKNIVYCTTYETIQTILGFGMFTIALIALIVKLLKNDNKK
ISLKNTNKNIVYCTTYETIQTILGFGMFTIALIALIVKLLKNDNKK
Download Length: 141 bp
Antitoxin
Download Length: 185 bp
>AT267577 NZ_CP115992:c1891997-1891813 [Enterococcus faecalis]
TGCTACAATAGAGACGAAAAGAGAGGTATGCTCTAACATACCTCTCTAGTGTAGAGCCGTTTCAGACGGTGACCTTTTTA
GTTACAAAAAATAACCGTACTCAGTCAAAGTAGACGGTTATTTTTTCTTGTCATTTTTAAGCAATTTCACAATCAGCGCA
ATCAAATCAATGGTAAACATACCAA
TGCTACAATAGAGACGAAAAGAGAGGTATGCTCTAACATACCTCTCTAGTGTAGAGCCGTTTCAGACGGTGACCTTTTTA
GTTACAAAAAATAACCGTACTCAGTCAAAGTAGACGGTTATTTTTTCTTGTCATTTTTAAGCAATTTCACAATCAGCGCA
ATCAAATCAATGGTAAACATACCAA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|