Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 887084..887925 | Replicon | plasmid pmega |
| Accession | NZ_CP115956 | ||
| Organism | Ralstonia pseudosolanacearum strain RUN2340 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | - |
| Locus tag | PG907_RS21570 | Protein ID | WP_197366231.1 |
| Coordinates | 887084..887599 (-) | Length | 172 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | - |
| Locus tag | PG907_RS21575 | Protein ID | WP_193028732.1 |
| Coordinates | 887596..887925 (-) | Length | 110 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PG907_RS21555 | 883166..884044 | - | 879 | WP_193028734.1 | EamA family transporter | - |
| PG907_RS21560 | 884282..885178 | - | 897 | WP_043899999.1 | LysR substrate-binding domain-containing protein | - |
| PG907_RS21565 | 885311..886639 | - | 1329 | WP_193027137.1 | IS4 family transposase | - |
| PG907_RS21570 | 887084..887599 | - | 516 | WP_197366231.1 | type II toxin-antitoxin system YhaV family toxin | Toxin |
| PG907_RS21575 | 887596..887925 | - | 330 | WP_193028732.1 | type II toxin-antitoxin system PrlF family antitoxin | Antitoxin |
| PG907_RS21585 | 889065..889271 | + | 207 | Protein_735 | JAB domain-containing protein | - |
| PG907_RS21590 | 889330..890511 | + | 1182 | WP_193028729.1 | PDDEXK nuclease domain-containing protein | - |
| PG907_RS21595 | 890666..891526 | - | 861 | WP_197366230.1 | spermidine synthase | - |
| PG907_RS21600 | 891830..892765 | + | 936 | WP_193037658.1 | 5-dehydro-4-deoxyglucarate dehydratase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | cyaB / flgC / flgG / fliM / fliI / acrB / adeG / cheY / cheB / cheW / motA | 1..1973144 | 1973144 | |
| - | flank | IS/Tn | - | - | 885311..886639 | 1328 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 172 a.a. Molecular weight: 19671.40 Da Isoelectric Point: 9.6724
>T267549 WP_197366231.1 NZ_CP115956:c887599-887084 [Ralstonia pseudosolanacearum]
MTAVQPVPLVIHGWTIFAHPLLLDQLDALTRQVEAQREKDPTGYVKKNATKRLAAICKLAFDVIPQDPARPEYRQGHTLG
DENKHWFRAKFFQQYRLFFRFHAPSKMIVLAWINDADTKRAYESDDDAYRVFKRMLASGHPPNDWEPLLTEASRQSERLQ
STAGALGTGHR
MTAVQPVPLVIHGWTIFAHPLLLDQLDALTRQVEAQREKDPTGYVKKNATKRLAAICKLAFDVIPQDPARPEYRQGHTLG
DENKHWFRAKFFQQYRLFFRFHAPSKMIVLAWINDADTKRAYESDDDAYRVFKRMLASGHPPNDWEPLLTEASRQSERLQ
STAGALGTGHR
Download Length: 516 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|