Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/MqsA(antitoxin) |
Location | 105435..106072 | Replicon | plasmid pmega |
Accession | NZ_CP115953 | ||
Organism | Ralstonia solanacearum CFBP2957 |
Toxin (Protein)
Gene name | higB | Uniprot ID | D8P759 |
Locus tag | PG903_RS16640 | Protein ID | WP_013207463.1 |
Coordinates | 105435..105764 (+) | Length | 110 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PG903_RS16645 | Protein ID | WP_176462254.1 |
Coordinates | 105761..106072 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PG903_RS16625 | 101140..102303 | - | 1164 | WP_013207460.1 | 2-methylcitrate synthase | - |
PG903_RS16630 | 102342..103238 | - | 897 | WP_013207461.1 | methylisocitrate lyase | - |
PG903_RS16635 | 103432..105384 | + | 1953 | WP_013207462.1 | propionate catabolism operon regulatory protein PrpR | - |
PG903_RS16640 | 105435..105764 | + | 330 | WP_013207463.1 | hypothetical protein | Toxin |
PG903_RS16645 | 105761..106072 | + | 312 | WP_176462254.1 | transcriptional regulator | Antitoxin |
PG903_RS16650 | 106304..106612 | - | 309 | WP_176462255.1 | type II toxin-antitoxin system YafQ family toxin | - |
PG903_RS16655 | 106557..106853 | - | 297 | WP_013207466.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
PG903_RS16660 | 107455..108288 | - | 834 | WP_176462402.1 | DUF2242 domain-containing protein | - |
PG903_RS16665 | 108570..108941 | + | 372 | WP_013207469.1 | hypothetical protein | - |
PG903_RS16670 | 109134..109874 | - | 741 | WP_013207470.1 | metallophosphoesterase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | cheY / cyaB / flgG / fliM / fliI / acrB / adeG / cheY / cheB / cheW / motA | 1..2210741 | 2210741 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 12425.94 Da Isoelectric Point: 5.2566
>T267536 WP_013207463.1 NZ_CP115953:105435-105764 [Ralstonia solanacearum CFBP2957]
MDATPIELPGEHDLSDDEYSALQQELLAQPDAGDVIKGTGGLRKLRFSDKRRGKGKRGGLRVIYYHWDGGSQFWMFVVYD
KDEAIDLSSDERKVLARLLEQEVKARSER
MDATPIELPGEHDLSDDEYSALQQELLAQPDAGDVIKGTGGLRKLRFSDKRRGKGKRGGLRVIYYHWDGGSQFWMFVVYD
KDEAIDLSSDERKVLARLLEQEVKARSER
Download Length: 330 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|