Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/MqsA(antitoxin) |
| Location | 110719..111356 | Replicon | plasmid pmega |
| Accession | NZ_CP115947 | ||
| Organism | Ralstonia solanacearum MolK2 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A1C0UHE0 |
| Locus tag | PG909_RS14115 | Protein ID | WP_003262800.1 |
| Coordinates | 110719..111048 (+) | Length | 110 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PG909_RS14120 | Protein ID | WP_003274539.1 |
| Coordinates | 111045..111356 (+) | Length | 104 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PG909_RS14100 | 106428..107591 | - | 1164 | WP_197336754.1 | 2-methylcitrate synthase | - |
| PG909_RS14105 | 107629..108525 | - | 897 | WP_003274537.1 | methylisocitrate lyase | - |
| PG909_RS14110 | 108719..110668 | + | 1950 | WP_003274538.1 | propionate catabolism operon regulatory protein PrpR | - |
| PG909_RS14115 | 110719..111048 | + | 330 | WP_003262800.1 | hypothetical protein | Toxin |
| PG909_RS14120 | 111045..111356 | + | 312 | WP_003274539.1 | transcriptional regulator | Antitoxin |
| PG909_RS14125 | 111507..111815 | - | 309 | WP_003262797.1 | type II toxin-antitoxin system YafQ family toxin | - |
| PG909_RS14130 | 111760..112071 | - | 312 | WP_003262795.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
| PG909_RS14135 | 112658..113491 | - | 834 | WP_042551581.1 | DUF2242 domain-containing protein | - |
| PG909_RS14140 | 113689..114006 | + | 318 | Protein_96 | IS5/IS1182 family transposase | - |
| PG909_RS14145 | 114540..114761 | + | 222 | WP_080895126.1 | hypothetical protein | - |
| PG909_RS14150 | 114901..115311 | - | 411 | WP_042550962.1 | hypothetical protein | - |
| PG909_RS14155 | 115319..116059 | - | 741 | WP_003274543.1 | metallophosphoesterase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | cheY / icl | 1..2326525 | 2326525 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 12457.90 Da Isoelectric Point: 4.9855
>T267530 WP_003262800.1 NZ_CP115947:110719-111048 [Ralstonia solanacearum MolK2]
MDATPIELPGEHDLSDDEYSALQQELLAQPDAGDVIKGTGGLRKLRFSDKRRGKGKRGGLRVIYYHWDGSSQFWMFVVYD
KDEADDLSSDERKVLARLLEQEVKARSER
MDATPIELPGEHDLSDDEYSALQQELLAQPDAGDVIKGTGGLRKLRFSDKRRGKGKRGGLRVIYYHWDGSSQFWMFVVYD
KDEADDLSSDERKVLARLLEQEVKARSER
Download Length: 330 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|