Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/MqsA(antitoxin) |
Location | 104837..105489 | Replicon | plasmid pmega |
Accession | NZ_CP115945 | ||
Organism | Ralstonia syzygii R24 |
Toxin (Protein)
Gene name | higB | Uniprot ID | G3AAL2 |
Locus tag | PG906_RS18220 | Protein ID | WP_075465943.1 |
Coordinates | 104837..105181 (+) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PG906_RS18225 | Protein ID | WP_197334098.1 |
Coordinates | 105178..105489 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PG906_RS18205 | 100560..101723 | - | 1164 | WP_197333672.1 | 2-methylcitrate synthase | - |
PG906_RS18210 | 101758..102654 | - | 897 | WP_197334100.1 | methylisocitrate lyase | - |
PG906_RS18215 | 102849..104786 | + | 1938 | WP_197334099.1 | propionate catabolism operon regulatory protein PrpR | - |
PG906_RS18220 | 104837..105181 | + | 345 | WP_075465943.1 | toxin | Toxin |
PG906_RS18225 | 105178..105489 | + | 312 | WP_197334098.1 | transcriptional regulator | Antitoxin |
PG906_RS18230 | 105628..106455 | - | 828 | WP_197334097.1 | DUF2242 domain-containing protein | - |
PG906_RS18235 | 106760..107314 | + | 555 | WP_197334096.1 | hypothetical protein | - |
PG906_RS18240 | 107555..108295 | - | 741 | WP_197334095.1 | metallophosphoesterase family protein | - |
PG906_RS18245 | 108566..110383 | + | 1818 | WP_231649772.1 | 3'-5' exonuclease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | cheY / cyaB / flgC / flgG / fliM / fliG / fliI / adeG / cheY / cheB / cheW / motA | 1..1751279 | 1751279 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13434.09 Da Isoelectric Point: 5.9519
>T267524 WP_075465943.1 NZ_CP115945:104837-105181 [Ralstonia syzygii R24]
MDATFIELPPFQRLREHYLSDDEYRALQQELLAQPDAGDVIRGTSGLRKLRFSDKRRGKGKRGGLRVIYYYWDEGGQFWM
FAVYDKDEADDLSSDERKVLARLLEQEVKARSER
MDATFIELPPFQRLREHYLSDDEYRALQQELLAQPDAGDVIRGTSGLRKLRFSDKRRGKGKRGGLRVIYYYWDEGGQFWM
FAVYDKDEADDLSSDERKVLARLLEQEVKARSER
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|