267497

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 325518..326104 Replicon chromosome
Accession NZ_CP115930
Organism Klebsiella pneumoniae subsp. pneumoniae strain 43UC01

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag DLD89_RS01510 Protein ID WP_002920800.1
Coordinates 325736..326104 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A0H3GZM4
Locus tag DLD89_RS01505 Protein ID WP_002920802.1
Coordinates 325518..325739 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DLD89_RS01485 (DLD89_01485) 321675..322601 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
DLD89_RS01490 (DLD89_01490) 322598..323875 + 1278 WP_002920806.1 branched chain amino acid ABC transporter permease LivM -
DLD89_RS01495 (DLD89_01495) 323872..324639 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
DLD89_RS01500 (DLD89_01500) 324641..325354 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
DLD89_RS01505 (DLD89_01505) 325518..325739 + 222 WP_002920802.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
DLD89_RS01510 (DLD89_01510) 325736..326104 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
DLD89_RS01515 (DLD89_01515) 326377..327693 + 1317 WP_002920796.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
DLD89_RS01520 (DLD89_01520) 327800..328687 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
DLD89_RS01525 (DLD89_01525) 328684..329529 + 846 WP_002920789.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
DLD89_RS01530 (DLD89_01530) 329531..330601 + 1071 WP_002920787.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 315285..331338 16053


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T267497 WP_002920800.1 NZ_CP115930:325736-326104 [Klebsiella pneumoniae subsp. pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8181.18 Da        Isoelectric Point: 4.7769

>AT267497 WP_002920802.1 NZ_CP115930:325518-325739 [Klebsiella pneumoniae subsp. pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZM4

References