Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 219047..219683 | Replicon | plasmid pAtK224a |
| Accession | NZ_CP115926 | ||
| Organism | Agrobacterium fabacearum strain K224 | ||
Toxin (Protein)
| Gene name | graT | Uniprot ID | - |
| Locus tag | G6L41_RS23840 | Protein ID | WP_173994831.1 |
| Coordinates | 219047..219328 (+) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | graA | Uniprot ID | - |
| Locus tag | G6L41_RS23845 | Protein ID | WP_025594268.1 |
| Coordinates | 219384..219683 (+) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| G6L41_RS23815 (G6L41_023815) | 214629..214907 | + | 279 | WP_149916628.1 | helix-turn-helix transcriptional regulator | - |
| G6L41_RS23820 (G6L41_023820) | 214911..215194 | + | 284 | Protein_203 | restriction endonuclease subunit R | - |
| G6L41_RS23825 (G6L41_023825) | 216320..217240 | - | 921 | WP_173994833.1 | LysR family transcriptional regulator | - |
| G6L41_RS23830 (G6L41_023830) | 217484..218398 | + | 915 | WP_173994832.1 | nucleotidyltransferase and HEPN domain-containing protein | - |
| G6L41_RS23835 (G6L41_023835) | 218482..218882 | - | 401 | Protein_206 | M15 family metallopeptidase | - |
| G6L41_RS23840 (G6L41_023840) | 219047..219328 | + | 282 | WP_173994831.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| G6L41_RS23845 (G6L41_023845) | 219384..219683 | + | 300 | WP_025594268.1 | HigA family addiction module antitoxin | Antitoxin |
| G6L41_RS23850 (G6L41_023850) | 220027..220272 | - | 246 | WP_173994830.1 | hypothetical protein | - |
| G6L41_RS23855 (G6L41_023855) | 220373..221269 | - | 897 | WP_236762325.1 | contractile injection system protein, VgrG/Pvc8 family | - |
| G6L41_RS23860 (G6L41_023860) | 221380..222090 | - | 711 | WP_173994829.1 | autoinducer binding domain-containing protein | - |
| G6L41_RS23865 (G6L41_023865) | 222087..222851 | - | 765 | WP_173994828.1 | acyl-homoserine-lactone synthase | - |
| G6L41_RS23870 (G6L41_023870) | 223008..223727 | - | 720 | WP_173994827.1 | LuxR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..485342 | 485342 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10641.05 Da Isoelectric Point: 8.0459
>T267494 WP_173994831.1 NZ_CP115926:219047-219328 [Agrobacterium fabacearum]
MIRSFKNRLTSSIDDGSVKKGFPADLVRRAQQLLTILDAATTVEDLRSPPGNRLEKLFGDREGQHSIRINKQWRICFVWT
EAGPDNVEITDYH
MIRSFKNRLTSSIDDGSVKKGFPADLVRRAQQLLTILDAATTVEDLRSPPGNRLEKLFGDREGQHSIRINKQWRICFVWT
EAGPDNVEITDYH
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|