Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4799322..4799911 | Replicon | chromosome |
| Accession | NZ_CP115911 | ||
| Organism | Xanthomonas oryzae pv. oryzae strain NE-8 | ||
Toxin (Protein)
| Gene name | graT | Uniprot ID | A0A8E2YMU3 |
| Locus tag | PEV90_RS22695 | Protein ID | WP_011260747.1 |
| Coordinates | 4799630..4799911 (-) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PEV90_RS22690 | Protein ID | WP_011260746.1 |
| Coordinates | 4799322..4799612 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PEV90_RS22660 (PEV90_22660) | 4794466..4795074 | - | 609 | WP_011409746.1 | DUF4123 domain-containing protein | - |
| PEV90_RS22665 (PEV90_22665) | 4795077..4795499 | - | 423 | WP_042465811.1 | PAAR domain-containing protein | - |
| PEV90_RS22670 (PEV90_22670) | 4795627..4795953 | - | 327 | WP_228329596.1 | hypothetical protein | - |
| PEV90_RS22675 (PEV90_22675) | 4796208..4796540 | + | 333 | WP_011260743.1 | hypothetical protein | - |
| PEV90_RS22680 (PEV90_22680) | 4796700..4796887 | + | 188 | Protein_4333 | hypothetical protein | - |
| PEV90_RS22685 (PEV90_22685) | 4796990..4798384 | - | 1395 | WP_027703652.1 | type III secretion system effector XopQ | - |
| PEV90_RS22690 (PEV90_22690) | 4799322..4799612 | - | 291 | WP_011260746.1 | HigA family addiction module antitoxin | Antitoxin |
| PEV90_RS22695 (PEV90_22695) | 4799630..4799911 | - | 282 | WP_011260747.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PEV90_RS22700 (PEV90_22700) | 4800006..4802258 | - | 2253 | WP_011409750.1 | exodeoxyribonuclease V subunit alpha | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 11070.83 Da Isoelectric Point: 10.2139
>T267489 WP_011260747.1 NZ_CP115911:c4799911-4799630 [Xanthomonas oryzae pv. oryzae]
MIRSFIDKDAEKIWLGERSRRLPADIQLVARRKLRMLNAAAHLDDLRIPPANRLEALKGQQRGQYSIRINDQWRICFRWM
EGDVVQVEIVDYH
MIRSFIDKDAEKIWLGERSRRLPADIQLVARRKLRMLNAAAHLDDLRIPPANRLEALKGQQRGQYSIRINDQWRICFRWM
EGDVVQVEIVDYH
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|