Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprG-sprF/- |
| Location | 2228287..2228504 | Replicon | chromosome |
| Accession | NZ_CP115887 | ||
| Organism | Staphylococcus aureus strain C308 | ||
Toxin (Protein)
| Gene name | SprG3 | Uniprot ID | - |
| Locus tag | PCM89_RS11080 | Protein ID | WP_075583739.1 |
| Coordinates | 2228400..2228504 (-) | Length | 35 a.a. |
Antitoxin (RNA)
| Gene name | SprF1 | ||
| Locus tag | - | ||
| Coordinates | 2228287..2228342 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PCM89_RS11055 | 2224409..2225074 | - | 666 | WP_238612112.1 | SDR family oxidoreductase | - |
| PCM89_RS11060 | 2225226..2225546 | + | 321 | WP_000003755.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
| PCM89_RS11065 | 2225548..2226528 | + | 981 | WP_000019744.1 | CDF family zinc efflux transporter CzrB | - |
| PCM89_RS11070 | 2226794..2227885 | + | 1092 | WP_000495678.1 | hypothetical protein | - |
| - | 2228287..2228342 | + | 56 | - | - | Antitoxin |
| PCM89_RS11080 | 2228400..2228504 | - | 105 | WP_075583739.1 | hypothetical protein | Toxin |
| PCM89_RS11085 | 2228602..2228763 | - | 162 | Protein_2146 | helix-turn-helix domain-containing protein | - |
| PCM89_RS11090 | 2229181..2229339 | + | 159 | WP_024928151.1 | hypothetical protein | - |
| PCM89_RS11095 | 2229999..2230856 | - | 858 | WP_000370944.1 | HAD family hydrolase | - |
| PCM89_RS11100 | 2230924..2231706 | - | 783 | WP_000908181.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3861.73 Da Isoelectric Point: 7.0039
>T267469 WP_075583739.1 NZ_CP115887:c2228504-2228400 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISNQGHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISNQGHKK
Download Length: 105 bp
Antitoxin
Download Length: 56 bp
>AT267469 NZ_CP115887:2228287-2228342 [Staphylococcus aureus]
AAAAAGGGCAACACTCAGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCAGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|