Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF1/- |
| Location | 2050047..2050354 | Replicon | chromosome |
| Accession | NZ_CP115887 | ||
| Organism | Staphylococcus aureus strain C308 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | Q2FWU9 |
| Locus tag | PCM89_RS10060 | Protein ID | WP_011447039.1 |
| Coordinates | 2050178..2050354 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF1 | ||
| Locus tag | - | ||
| Coordinates | 2050047..2050186 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PCM89_RS10020 (2045386) | 2045386..2045646 | + | 261 | WP_001791826.1 | hypothetical protein | - |
| PCM89_RS10025 (2045699) | 2045699..2046049 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| PCM89_RS10030 (2046734) | 2046734..2047183 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| PCM89_RS10035 (2047278) | 2047278..2047613 | - | 336 | Protein_1941 | SH3 domain-containing protein | - |
| PCM89_RS10040 (2048263) | 2048263..2048754 | - | 492 | WP_000919349.1 | staphylokinase | - |
| PCM89_RS10045 (2048945) | 2048945..2049700 | - | 756 | WP_000861039.1 | CHAP domain-containing protein | - |
| PCM89_RS10050 (2049712) | 2049712..2049966 | - | 255 | WP_000611512.1 | phage holin | - |
| PCM89_RS10055 (2050018) | 2050018..2050125 | + | 108 | WP_001791821.1 | hypothetical protein | - |
| - (2050047) | 2050047..2050186 | + | 140 | NuclAT_1 | - | Antitoxin |
| - (2050047) | 2050047..2050186 | + | 140 | NuclAT_1 | - | Antitoxin |
| - (2050047) | 2050047..2050186 | + | 140 | NuclAT_1 | - | Antitoxin |
| - (2050047) | 2050047..2050186 | + | 140 | NuclAT_1 | - | Antitoxin |
| PCM89_RS10060 (2050178) | 2050178..2050354 | - | 177 | WP_011447039.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
| PCM89_RS10065 (2050504) | 2050504..2050800 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| PCM89_RS10070 (2050858) | 2050858..2051145 | - | 288 | WP_001040261.1 | hypothetical protein | - |
| PCM89_RS10075 (2051192) | 2051192..2051344 | - | 153 | WP_001153681.1 | hypothetical protein | - |
| PCM89_RS10080 (2051334) | 2051334..2055119 | - | 3786 | WP_000582168.1 | phage tail spike protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | scn / chp / sak / hlb / groEL | 2045699..2102393 | 56694 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T267465 WP_011447039.1 NZ_CP115887:c2050354-2050178 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 140 bp
>AT267465 NZ_CP115887:2050047-2050186 [Staphylococcus aureus]
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|