Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) sprA1-sprA1AS/-
Location 1894704..1894884 Replicon chromosome
Accession NZ_CP115887
Organism Staphylococcus aureus strain C308

Toxin (Protein)


Gene name sprA1 Uniprot ID -
Locus tag PCM89_RS09075 Protein ID WP_001801861.1
Coordinates 1894704..1894799 (+) Length 32 a.a.

Antitoxin (RNA)


Gene name sprA1AS
Locus tag -
Coordinates 1894827..1894884 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PCM89_RS09050 1889991..1890758 - 768 WP_001095317.1 IS21-like element helper ATPase IstB -
PCM89_RS09055 1890770..1891966 - 1197 WP_142386501.1 IS21 family transposase -
PCM89_RS09060 1892363..1893003 - 641 Protein_1785 ImmA/IrrE family metallo-endopeptidase -
PCM89_RS09065 1893305..1893481 - 177 WP_000375476.1 hypothetical protein -
PCM89_RS09070 1893492..1893875 - 384 WP_000070809.1 hypothetical protein -
PCM89_RS09075 1894704..1894799 + 96 WP_001801861.1 type I toxin-antitoxin system Fst family toxin PepA1 Toxin
- 1894827..1894884 - 58 - - Antitoxin
PCM89_RS09080 1894922..1895023 + 102 WP_001791232.1 hypothetical protein -
PCM89_RS09085 1895001..1895173 - 173 Protein_1790 transposase -
PCM89_RS09090 1895367..1895744 - 378 WP_001036002.1 DUF1433 domain-containing protein -
PCM89_RS09095 1895950..1896390 - 441 WP_000759947.1 DUF1433 domain-containing protein -
PCM89_RS09100 1896435..1898048 + 1614 WP_000926708.1 lipase -
PCM89_RS09105 1898063..1898362 + 300 WP_000095392.1 WXG100 family type VII secretion target -
PCM89_RS09110 1898679..1899860 - 1182 WP_000162901.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - selk 1865353..1911114 45761


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 32 a.a.        Molecular weight: 3554.32 Da        Isoelectric Point: 10.4449

>T267463 WP_001801861.1 NZ_CP115887:1894704-1894799 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK

Download         Length: 96 bp

Antitoxin


Download         Length: 58 bp

>AT267463 NZ_CP115887:c1894884-1894827 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References