Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-MW1433/- |
| Location | 1525648..1525955 | Replicon | chromosome |
| Accession | NZ_CP115887 | ||
| Organism | Staphylococcus aureus strain C308 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | Q2FWU9 |
| Locus tag | PCM89_RS07165 | Protein ID | WP_011447039.1 |
| Coordinates | 1525779..1525955 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | MW1433 | ||
| Locus tag | - | ||
| Coordinates | 1525648..1525787 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PCM89_RS07135 (1520890) | 1520890..1521105 | - | 216 | WP_170267452.1 | hypothetical protein | - |
| PCM89_RS07140 (1521284) | 1521284..1522294 | - | 1011 | WP_000777019.1 | restriction endonuclease subunit S | - |
| PCM89_RS07145 (1522281) | 1522281..1524185 | - | 1905 | WP_001003363.1 | N-6 DNA methylase | - |
| PCM89_RS07150 (1524546) | 1524546..1525301 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| PCM89_RS07155 (1525313) | 1525313..1525567 | - | 255 | WP_000611512.1 | phage holin | - |
| PCM89_RS07160 (1525619) | 1525619..1525726 | + | 108 | WP_001791821.1 | hypothetical protein | - |
| - (1525648) | 1525648..1525787 | + | 140 | NuclAT_0 | - | Antitoxin |
| - (1525648) | 1525648..1525787 | + | 140 | NuclAT_0 | - | Antitoxin |
| - (1525648) | 1525648..1525787 | + | 140 | NuclAT_0 | - | Antitoxin |
| - (1525648) | 1525648..1525787 | + | 140 | NuclAT_0 | - | Antitoxin |
| PCM89_RS07165 (1525779) | 1525779..1525955 | - | 177 | WP_011447039.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
| PCM89_RS07170 (1526108) | 1526108..1526407 | - | 300 | WP_000466784.1 | DUF2951 domain-containing protein | - |
| PCM89_RS07175 (1526453) | 1526453..1526617 | - | 165 | WP_000916020.1 | XkdX family protein | - |
| PCM89_RS07180 (1526610) | 1526610..1526999 | - | 390 | WP_001166596.1 | DUF2977 domain-containing protein | - |
| PCM89_RS07185 (1526999) | 1526999..1528465 | - | 1467 | WP_000067127.1 | BppU family phage baseplate upper protein | - |
| PCM89_RS07190 (1528465) | 1528465..1530375 | - | 1911 | WP_000429558.1 | minor structural protein | - |
| PCM89_RS07195 (1530391) | 1530391..1530681 | - | 291 | WP_000179858.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1520890..1580451 | 59561 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T267458 WP_011447039.1 NZ_CP115887:c1525955-1525779 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 140 bp
>AT267458 NZ_CP115887:1525648-1525787 [Staphylococcus aureus]
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
