Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 2881922..2882582 | Replicon | chromosome |
| Accession | NZ_CP115874 | ||
| Organism | Enterobacter hormaechei subsp. steigerwaltii strain WYTS.MG41 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | PBS85_RS13650 | Protein ID | WP_265188005.1 |
| Coordinates | 2882229..2882582 (-) | Length | 118 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A2J0Q4Z7 |
| Locus tag | PBS85_RS13645 | Protein ID | WP_017383313.1 |
| Coordinates | 2881922..2882224 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PBS85_RS13630 (PBS85_13630) | 2878096..2879421 | + | 1326 | WP_047063111.1 | SidA/IucD/PvdA family monooxygenase | - |
| PBS85_RS13635 (PBS85_13635) | 2879448..2881637 | + | 2190 | WP_032654151.1 | TonB-dependent siderophore receptor | - |
| PBS85_RS13645 (PBS85_13645) | 2881922..2882224 | - | 303 | WP_017383313.1 | XRE family transcriptional regulator | Antitoxin |
| PBS85_RS13650 (PBS85_13650) | 2882229..2882582 | - | 354 | WP_265188005.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PBS85_RS13655 (PBS85_13655) | 2882773..2883723 | - | 951 | WP_077580305.1 | HTH-type transcriptional regulator Cbl | - |
| PBS85_RS13660 (PBS85_13660) | 2883820..2884737 | - | 918 | WP_003859531.1 | nitrogen assimilation transcriptional regulator NAC | - |
| PBS85_RS13670 (PBS85_13670) | 2885269..2886201 | - | 933 | WP_015572412.1 | L,D-transpeptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13523.34 Da Isoelectric Point: 9.9538
>T267451 WP_265188005.1 NZ_CP115874:c2882582-2882229 [Enterobacter hormaechei subsp. steigerwaltii]
VWAVKTTDRFDDWFTSLNDSERASVLAALLVLRERGPGLSRPYADTLKGSRHSNMKELRIQSKGDPLRAFFAFDPNRTGI
VLCAGNKVGNERRFYDEMLLVADREYTRWLNTLKERN
VWAVKTTDRFDDWFTSLNDSERASVLAALLVLRERGPGLSRPYADTLKGSRHSNMKELRIQSKGDPLRAFFAFDPNRTGI
VLCAGNKVGNERRFYDEMLLVADREYTRWLNTLKERN
Download Length: 354 bp
Antitoxin
Download Length: 101 a.a. Molecular weight: 11028.85 Da Isoelectric Point: 6.4727
>AT267451 WP_017383313.1 NZ_CP115874:c2882224-2881922 [Enterobacter hormaechei subsp. steigerwaltii]
MGRTLEQLIADEKPEVVASAQAMATDILLNIHLAELREKVQKTQVDMARALGIKQPTVAVMEKAGRDIKLSSLKRYVEAA
GGKLRLDVELPDGSHYEFVL
MGRTLEQLIADEKPEVVASAQAMATDILLNIHLAELREKVQKTQVDMARALGIKQPTVAVMEKAGRDIKLSSLKRYVEAA
GGKLRLDVELPDGSHYEFVL
Download Length: 303 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|