Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 322899..323485 Replicon chromosome
Accession NZ_CP115837
Organism Klebsiella pneumoniae strain MRSN22265

Toxin (Protein)


Gene name doc Uniprot ID A0A331ME34
Locus tag KFB76_RS01500 Protein ID WP_025861226.1
Coordinates 323117..323485 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag KFB76_RS01495 Protein ID WP_004174006.1
Coordinates 322899..323120 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KFB76_RS01475 (KFB76_001475) 319056..319982 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
KFB76_RS01480 (KFB76_001480) 319979..321256 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
KFB76_RS01485 (KFB76_001485) 321253..322020 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
KFB76_RS01490 (KFB76_001490) 322022..322735 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
KFB76_RS01495 (KFB76_001495) 322899..323120 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
KFB76_RS01500 (KFB76_001500) 323117..323485 + 369 WP_025861226.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
KFB76_RS01505 (KFB76_001505) 323758..325074 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
KFB76_RS01510 (KFB76_001510) 325181..326068 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
KFB76_RS01515 (KFB76_001515) 326065..326910 + 846 WP_004145129.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
KFB76_RS01520 (KFB76_001520) 326912..327982 + 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 319979..328719 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-121)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13551.98 Da        Isoelectric Point: 8.6410

>T267416 WP_025861226.1 NZ_CP115837:323117-323485 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGIKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT267416 WP_004174006.1 NZ_CP115837:322899-323120 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A331ME34

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References