Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
| Location | 3881276..3881873 | Replicon | chromosome |
| Accession | NZ_CP115831 | ||
| Organism | Klebsiella pneumoniae strain L4-FAA5 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | R4YIC5 |
| Locus tag | PGO70_RS18665 | Protein ID | WP_004142563.1 |
| Coordinates | 3881556..3881873 (-) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | R4YH91 |
| Locus tag | PGO70_RS18660 | Protein ID | WP_004142561.1 |
| Coordinates | 3881276..3881563 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PGO70_RS18630 (3877356) | 3877356..3877604 | + | 249 | WP_032445695.1 | DUF1158 domain-containing protein | - |
| PGO70_RS18635 (3877622) | 3877622..3877963 | - | 342 | WP_002893035.1 | RamA family antibiotic efflux transcriptional regulator | - |
| PGO70_RS18640 (3877994) | 3877994..3879109 | - | 1116 | WP_012737592.1 | MBL fold metallo-hydrolase | - |
| PGO70_RS18645 (3879289) | 3879289..3879870 | + | 582 | Protein_3658 | TetR/AcrR family transcriptional regulator | - |
| PGO70_RS18650 (3879870) | 3879870..3880238 | + | 369 | WP_004142557.1 | MmcQ/YjbR family DNA-binding protein | - |
| PGO70_RS18655 (3880358) | 3880358..3881011 | + | 654 | WP_004178896.1 | oxygen-insensitive NAD(P)H nitroreductase | - |
| PGO70_RS18660 (3881276) | 3881276..3881563 | - | 288 | WP_004142561.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| PGO70_RS18665 (3881556) | 3881556..3881873 | - | 318 | WP_004142563.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PGO70_RS18670 (3882058) | 3882058..3883101 | - | 1044 | WP_016946853.1 | DUF2157 domain-containing protein | - |
| PGO70_RS18675 (3883767) | 3883767..3884633 | - | 867 | WP_004191455.1 | helix-turn-helix transcriptional regulator | - |
| PGO70_RS18680 (3884742) | 3884742..3886169 | + | 1428 | WP_004176980.1 | MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12110.39 Da Isoelectric Point: 11.2767
>T267406 WP_004142563.1 NZ_CP115831:c3881873-3881556 [Klebsiella pneumoniae]
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0M5MXH8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0S3DIQ1 |