Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 698936..699711 | Replicon | chromosome |
| Accession | NZ_CP115831 | ||
| Organism | Klebsiella pneumoniae strain L4-FAA5 | ||
Toxin (Protein)
| Gene name | TacT2 | Uniprot ID | - |
| Locus tag | PGO70_RS03495 | Protein ID | WP_032445441.1 |
| Coordinates | 699226..699711 (+) | Length | 162 a.a. |
Antitoxin (Protein)
| Gene name | TacA2 | Uniprot ID | W8UEW1 |
| Locus tag | PGO70_RS03490 | Protein ID | WP_004150912.1 |
| Coordinates | 698936..699229 (+) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PGO70_RS03470 (694144) | 694144..694746 | - | 603 | WP_020802400.1 | short chain dehydrogenase | - |
| PGO70_RS03475 (694844) | 694844..695755 | + | 912 | WP_004181308.1 | LysR family transcriptional regulator | - |
| PGO70_RS03480 (695756) | 695756..696904 | - | 1149 | WP_016947441.1 | PLP-dependent aspartate aminotransferase family protein | - |
| PGO70_RS03485 (696915) | 696915..698291 | - | 1377 | WP_072158501.1 | cystathionine beta-synthase | - |
| PGO70_RS03490 (698936) | 698936..699229 | + | 294 | WP_004150912.1 | DUF1778 domain-containing protein | Antitoxin |
| PGO70_RS03495 (699226) | 699226..699711 | + | 486 | WP_032445441.1 | GNAT family N-acetyltransferase | Toxin |
| PGO70_RS03500 (700415) | 700415..701008 | + | 594 | WP_032445442.1 | hypothetical protein | - |
| PGO70_RS03505 (701105) | 701105..701321 | + | 217 | Protein_688 | transposase | - |
| PGO70_RS03515 (701999) | 701999..702712 | - | 714 | WP_002916694.1 | DUF554 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| flank | IS/Tn | - | - | 701105..701257 | 152 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17580.59 Da Isoelectric Point: 8.1558
>T267399 WP_032445441.1 NZ_CP115831:699226-699711 [Klebsiella pneumoniae]
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPDPI
PVVVLGRLAVDKSLHGIGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPDPI
PVVVLGRLAVDKSLHGIGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|