Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 341616..342262 | Replicon | chromosome |
| Accession | NZ_CP115831 | ||
| Organism | Klebsiella pneumoniae strain L4-FAA5 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A231WWF9 |
| Locus tag | PGO70_RS01610 | Protein ID | WP_004174016.1 |
| Coordinates | 341616..341963 (+) | Length | 116 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PGO70_RS01615 | Protein ID | WP_223367845.1 |
| Coordinates | 342017..342262 (+) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PGO70_RS01600 (337542) | 337542..338975 | + | 1434 | WP_032445350.1 | glycogen synthase GlgA | - |
| PGO70_RS01605 (338993) | 338993..341440 | + | 2448 | WP_002920561.1 | glycogen phosphorylase | - |
| PGO70_RS01610 (341616) | 341616..341963 | + | 348 | WP_004174016.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PGO70_RS01615 (342017) | 342017..342262 | + | 246 | WP_223367845.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| PGO70_RS01620 (342325) | 342325..343833 | - | 1509 | WP_019704656.1 | glycerol-3-phosphate dehydrogenase | - |
| PGO70_RS01625 (344038) | 344038..344367 | + | 330 | WP_002920552.1 | thiosulfate sulfurtransferase GlpE | - |
| PGO70_RS01630 (344418) | 344418..345248 | + | 831 | WP_004151408.1 | rhomboid family intramembrane serine protease GlpG | - |
| PGO70_RS01635 (345298) | 345298..346056 | + | 759 | WP_002920548.1 | DeoR/GlpR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13518.55 Da Isoelectric Point: 6.2327
>T267398 WP_004174016.1 NZ_CP115831:341616-341963 [Klebsiella pneumoniae]
MWDVETTDTFDAWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGNKDGMNEKRFYKEMITLADREFSQHLTKER
MWDVETTDTFDAWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGNKDGMNEKRFYKEMITLADREFSQHLTKER
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|