Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 315431..316017 Replicon chromosome
Accession NZ_CP115831
Organism Klebsiella pneumoniae strain L4-FAA5

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag PGO70_RS01500 Protein ID WP_002920800.1
Coordinates 315649..316017 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag PGO70_RS01495 Protein ID WP_004174006.1
Coordinates 315431..315652 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PGO70_RS01475 (311588) 311588..312514 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
PGO70_RS01480 (312511) 312511..313788 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
PGO70_RS01485 (313785) 313785..314552 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
PGO70_RS01490 (314554) 314554..315267 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
PGO70_RS01495 (315431) 315431..315652 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PGO70_RS01500 (315649) 315649..316017 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
PGO70_RS01505 (316290) 316290..317606 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
PGO70_RS01510 (317713) 317713..318600 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
PGO70_RS01515 (318597) 318597..319442 + 846 WP_004174009.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
PGO70_RS01520 (319444) 319444..320514 + 1071 WP_032445345.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 312511..321251 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T267397 WP_002920800.1 NZ_CP115831:315649-316017 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT267397 WP_004174006.1 NZ_CP115831:315431-315652 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References