Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 23068..23651 | Replicon | plasmid p3 |
| Accession | NZ_CP115771 | ||
| Organism | Paracoccus sediminicola strain SCSIO 76264 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | PAF18_RS17120 | Protein ID | WP_271118326.1 |
| Coordinates | 23370..23651 (-) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | graA | Uniprot ID | - |
| Locus tag | PAF18_RS17115 | Protein ID | WP_271118325.1 |
| Coordinates | 23068..23358 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PAF18_RS17090 (PAF18_17090) | 18215..18385 | + | 171 | WP_271118321.1 | cbb3-type cytochrome c oxidase subunit 3 | - |
| PAF18_RS17095 (PAF18_17095) | 18376..19254 | + | 879 | WP_271118322.1 | cytochrome-c oxidase, cbb3-type subunit III | - |
| PAF18_RS17100 (PAF18_17100) | 19415..20296 | + | 882 | WP_271118323.1 | DUF2189 domain-containing protein | - |
| PAF18_RS17105 (PAF18_17105) | 20373..21056 | - | 684 | WP_271118324.1 | recombinase family protein | - |
| PAF18_RS17110 (PAF18_17110) | 21370..22566 | - | 1197 | WP_271115968.1 | IS256 family transposase | - |
| PAF18_RS17115 (PAF18_17115) | 23068..23358 | - | 291 | WP_271118325.1 | HigA family addiction module antitoxin | Antitoxin |
| PAF18_RS17120 (PAF18_17120) | 23370..23651 | - | 282 | WP_271118326.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PAF18_RS17125 (PAF18_17125) | 23808..24434 | - | 627 | WP_271118327.1 | hypothetical protein | - |
| PAF18_RS17130 (PAF18_17130) | 24518..24922 | - | 405 | WP_271118328.1 | hypothetical protein | - |
| PAF18_RS17135 (PAF18_17135) | 24915..25181 | - | 267 | WP_271118329.1 | ribbon-helix-helix protein, CopG family | - |
| PAF18_RS17140 (PAF18_17140) | 25174..25788 | - | 615 | WP_271118330.1 | ParA family protein | - |
| PAF18_RS17145 (PAF18_17145) | 26356..27552 | + | 1197 | WP_271115968.1 | IS256 family transposase | - |
| PAF18_RS17150 (PAF18_17150) | 27704..28327 | - | 624 | WP_271118331.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..29546 | 29546 | |
| - | inside | IScluster/Tn | - | - | 21370..27552 | 6182 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10484.08 Da Isoelectric Point: 10.1503
>T267375 WP_271118326.1 NZ_CP115771:c23651-23370 [Paracoccus sediminicola]
MIQSTKGKLIQDILANKAGKGFPAGIMKVARRKLTMLDAASKLEDLRVPPANRLEALQGDRKGQHSIRVNDQWRFCFVWT
ESGPADVEFTDYH
MIQSTKGKLIQDILANKAGKGFPAGIMKVARRKLTMLDAASKLEDLRVPPANRLEALQGDRKGQHSIRVNDQWRFCFVWT
ESGPADVEFTDYH
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|