Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | yonT-SR6/- |
Location | 2221730..2221947 | Replicon | chromosome |
Accession | NZ_CP115738 | ||
Organism | Bacillus subtilis strain W7 |
Toxin (Protein)
Gene name | yonT | Uniprot ID | - |
Locus tag | OSK17_RS11485 | Protein ID | WP_109962752.1 |
Coordinates | 2221771..2221947 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SR6 | ||
Locus tag | - | ||
Coordinates | 2221730..2221830 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OSK17_RS11440 | 2216868..2217164 | - | 297 | WP_114168604.1 | hypothetical protein | - |
OSK17_RS11445 | 2217244..2217441 | - | 198 | WP_271069211.1 | hypothetical protein | - |
OSK17_RS11450 | 2217454..2217690 | - | 237 | WP_271069212.1 | hypothetical protein | - |
OSK17_RS11455 | 2217690..2218073 | - | 384 | WP_271069213.1 | hypothetical protein | - |
OSK17_RS11460 | 2218110..2218976 | - | 867 | WP_271069214.1 | hypothetical protein | - |
OSK17_RS11465 | 2219121..2219552 | - | 432 | WP_109962749.1 | hypothetical protein | - |
OSK17_RS11470 | 2219969..2221186 | - | 1218 | WP_109962750.1 | hypothetical protein | - |
OSK17_RS11475 | 2221268..2221456 | - | 189 | WP_003230987.1 | hypothetical protein | - |
OSK17_RS11480 | 2221501..2221752 | - | 252 | WP_109962751.1 | hypothetical protein | - |
- | 2221730..2221830 | + | 101 | - | - | Antitoxin |
OSK17_RS11485 | 2221771..2221947 | - | 177 | WP_109962752.1 | hypothetical protein | Toxin |
- | 2221888..2221988 | + | 101 | NuclAT_1 | - | - |
- | 2221888..2221988 | + | 101 | NuclAT_1 | - | - |
- | 2221888..2221988 | + | 101 | NuclAT_1 | - | - |
- | 2221888..2221988 | + | 101 | NuclAT_1 | - | - |
OSK17_RS11490 | 2222979..2223173 | + | 195 | WP_004399291.1 | hypothetical protein | - |
OSK17_RS11495 | 2223213..2225720 | + | 2508 | WP_109962753.1 | DNA-directed RNA polymerase YonO | - |
OSK17_RS11500 | 2225984..2226259 | + | 276 | WP_072692660.1 | HU family DNA-binding protein | - |
OSK17_RS11505 | 2226682..2226793 | + | 112 | Protein_2213 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2154124..2285049 | 130925 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6859.40 Da Isoelectric Point: 12.8196
>T267362 WP_109962752.1 NZ_CP115738:c2221947-2221771 [Bacillus subtilis]
VLEKVGIIVAFLISLTVLTINSLTIVEKIRNLKNGTSKKKKRIRKRLRPKRQRQHIRR
VLEKVGIIVAFLISLTVLTINSLTIVEKIRNLKNGTSKKKKRIRKRLRPKRQRQHIRR
Download Length: 177 bp
Antitoxin
Download Length: 101 bp
>AT267362 NZ_CP115738:2221730-2221830 [Bacillus subtilis]
TAGGAACTAAAGGAGAAGTTCATTCCCCTTTAGCTTAGCTCTCATCGGCGTATATGTTGGCGTTGTCTCTTTGGTCGGAG
CCGCTTGCGTATACGCTTTTT
TAGGAACTAAAGGAGAAGTTCATTCCCCTTTAGCTTAGCTCTCATCGGCGTATATGTTGGCGTTGTCTCTTTGGTCGGAG
CCGCTTGCGTATACGCTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|