Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HigB-HigA
Location 98975..99699 Replicon plasmid pKPN0421-1
Accession NZ_CP115715
Organism Klebsiella pneumoniae strain KPN0421

Toxin (Protein)


Gene name higB Uniprot ID A0A2J4YLV3
Locus tag PF051_RS26145 Protein ID WP_023292165.1
Coordinates 99388..99699 (-) Length 104 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag PF051_RS26140 Protein ID WP_023292164.1
Coordinates 98975..99391 (-) Length 139 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PF051_RS26110 (PF051_26110) 94559..94966 + 408 WP_226331063.1 transglycosylase SLT domain-containing protein -
PF051_RS26115 (PF051_26115) 95004..95534 - 531 WP_023292160.1 antirestriction protein -
PF051_RS26120 (PF051_26120) 96159..96992 - 834 WP_159215445.1 N-6 DNA methylase -
PF051_RS26125 (PF051_26125) 97039..97269 - 231 WP_004197732.1 hypothetical protein -
PF051_RS26130 (PF051_26130) 97357..97704 - 348 WP_159215446.1 hypothetical protein -
PF051_RS26135 (PF051_26135) 97771..98151 - 381 WP_023292163.1 hypothetical protein -
PF051_RS26140 (PF051_26140) 98975..99391 - 417 WP_023292164.1 helix-turn-helix domain-containing protein Antitoxin
PF051_RS26145 (PF051_26145) 99388..99699 - 312 WP_023292165.1 type II toxin-antitoxin system HigB family toxin Toxin
PF051_RS26150 (PF051_26150) 99806..100030 - 225 WP_023292166.1 hypothetical protein -
PF051_RS26155 (PF051_26155) 100041..100253 - 213 WP_055323553.1 hypothetical protein -
PF051_RS26160 (PF051_26160) 100316..100645 - 330 WP_165455231.1 hypothetical protein -
PF051_RS26165 (PF051_26165) 100657..100869 - 213 WP_055323555.1 hypothetical protein -
PF051_RS26170 (PF051_26170) 100907..101104 - 198 Protein_110 single-stranded DNA-binding protein -
PF051_RS26175 (PF051_26175) 101742..102059 - 318 WP_032747192.1 hypothetical protein -
PF051_RS26180 (PF051_26180) 102074..102424 - 351 WP_023292061.1 hypothetical protein -
PF051_RS26185 (PF051_26185) 102421..102693 - 273 WP_023292062.1 hypothetical protein -
PF051_RS26190 (PF051_26190) 102883..103368 + 486 WP_159215417.1 cytoplasmic protein -
PF051_RS26195 (PF051_26195) 103613..103735 - 123 WP_085842394.1 Hok/Gef family protein -
PF051_RS26200 (PF051_26200) 103680..103832 - 153 Protein_116 DUF5431 family protein -
PF051_RS26205 (PF051_26205) 103991..104317 - 327 WP_038992719.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..140065 140065


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, mRNA interferase HigB

(21-93)

Antitoxin

Antitoxin HigA

(5-138)


Sequences

Toxin        


Download         Length: 104 a.a.        Molecular weight: 12497.32 Da        Isoelectric Point: 9.9242

>T267355 WP_023292165.1 NZ_CP115715:c99699-99388 [Klebsiella pneumoniae]
VHVISRAPFDEAARHYPNDAAAIDDTYRVLKRVVAKKPDELKRYFTSLDRMKYREKWWVIDIGGNNLRMMFFADFERGKI
FVKHITTHAEYDRLTKYYREHKE

Download         Length: 312 bp

Antitoxin


Download         Length: 139 a.a.        Molecular weight: 15462.59 Da        Isoelectric Point: 4.4720

>AT267355 WP_023292164.1 NZ_CP115715:c99391-98975 [Klebsiella pneumoniae]
MIFSDAIKAANDLASIVPLLGGSSSRKDYEEALKLVEYLLEHDPDSPLVDMLAARIDAWEDNAVEFEEFNTRIEAGKNGV
SLLRVLMRQYGLSQSDFENEIGKKSLVSRILSGERSLTLDHMRALANRFQIPVSMFVD

Download         Length: 417 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2J4YLV3

Antitoxin

Source ID Structure

References