Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 735676..736451 | Replicon | chromosome |
| Accession | NZ_CP115714 | ||
| Organism | Klebsiella pneumoniae strain KPN0421 | ||
Toxin (Protein)
| Gene name | TacT2 | Uniprot ID | - |
| Locus tag | PF051_RS03660 | Protein ID | WP_060568463.1 |
| Coordinates | 735966..736451 (+) | Length | 162 a.a. |
Antitoxin (Protein)
| Gene name | TacA2 | Uniprot ID | W8UEW1 |
| Locus tag | PF051_RS03655 | Protein ID | WP_004150912.1 |
| Coordinates | 735676..735969 (+) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PF051_RS03635 (730884) | 730884..731486 | - | 603 | WP_004174410.1 | short chain dehydrogenase | - |
| PF051_RS03640 (731584) | 731584..732495 | + | 912 | WP_023342207.1 | LysR family transcriptional regulator | - |
| PF051_RS03645 (732496) | 732496..733644 | - | 1149 | WP_016947441.1 | PLP-dependent aspartate aminotransferase family protein | - |
| PF051_RS03650 (733655) | 733655..735031 | - | 1377 | WP_004174417.1 | pyridoxal-phosphate dependent enzyme | - |
| PF051_RS03655 (735676) | 735676..735969 | + | 294 | WP_004150912.1 | DUF1778 domain-containing protein | Antitoxin |
| PF051_RS03660 (735966) | 735966..736451 | + | 486 | WP_060568463.1 | GNAT family N-acetyltransferase | Toxin |
| PF051_RS03665 (737155) | 737155..737748 | + | 594 | WP_004188553.1 | hypothetical protein | - |
| PF051_RS03670 (737845) | 737845..738061 | + | 217 | Protein_720 | transposase | - |
| PF051_RS03680 (739065) | 739065..739778 | - | 714 | WP_002916694.1 | DUF554 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| flank | IS/Tn | - | - | 737845..737997 | 152 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17602.64 Da Isoelectric Point: 8.1629
>T267343 WP_060568463.1 NZ_CP115714:735966-736451 [Klebsiella pneumoniae]
MILAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRHNMPDPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
MILAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRHNMPDPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|