Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 328185..328771 Replicon chromosome
Accession NZ_CP115714
Organism Klebsiella pneumoniae strain KPN0421

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag PF051_RS01535 Protein ID WP_002920800.1
Coordinates 328403..328771 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID -
Locus tag PF051_RS01530 Protein ID WP_071081456.1
Coordinates 328185..328406 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PF051_RS01510 (324342) 324342..325268 + 927 WP_271118429.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
PF051_RS01515 (325265) 325265..326542 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
PF051_RS01520 (326539) 326539..327306 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
PF051_RS01525 (327308) 327308..328021 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
PF051_RS01530 (328185) 328185..328406 + 222 WP_071081456.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PF051_RS01535 (328403) 328403..328771 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
PF051_RS01540 (329044) 329044..330360 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
PF051_RS01545 (330467) 330467..331354 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
PF051_RS01550 (331351) 331351..332196 + 846 WP_004185988.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
PF051_RS01555 (332198) 332198..333268 + 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 325265..334005 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T267342 WP_002920800.1 NZ_CP115714:328403-328771 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8181.18 Da        Isoelectric Point: 4.7769

>AT267342 WP_071081456.1 NZ_CP115714:328185-328406 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHSDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure

References