Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 3658009..3658608 | Replicon | chromosome |
| Accession | NZ_CP115713 | ||
| Organism | Rhodopseudomonas palustris strain k7 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | OOZ54_RS17135 | Protein ID | WP_271100252.1 |
| Coordinates | 3658009..3658293 (+) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | OOZ54_RS17140 | Protein ID | WP_012496624.1 |
| Coordinates | 3658306..3658608 (+) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OOZ54_RS17110 (OOZ54_17110) | 3653071..3653358 | + | 288 | WP_271100248.1 | hypothetical protein | - |
| OOZ54_RS17115 (OOZ54_17115) | 3653424..3654233 | - | 810 | WP_271100249.1 | DUF1295 domain-containing protein | - |
| OOZ54_RS17120 (OOZ54_17120) | 3654339..3654887 | - | 549 | WP_271100250.1 | hypothetical protein | - |
| OOZ54_RS17125 (OOZ54_17125) | 3654976..3656709 | - | 1734 | WP_271100251.1 | bifunctional protein-serine/threonine kinase/phosphatase | - |
| OOZ54_RS17130 (OOZ54_17130) | 3656777..3657616 | - | 840 | WP_011158746.1 | formate/nitrite transporter family protein | - |
| OOZ54_RS17135 (OOZ54_17135) | 3658009..3658293 | + | 285 | WP_271100252.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OOZ54_RS17140 (OOZ54_17140) | 3658306..3658608 | + | 303 | WP_012496624.1 | HigA family addiction module antitoxin | Antitoxin |
| OOZ54_RS17145 (OOZ54_17145) | 3658791..3659648 | - | 858 | WP_271100253.1 | SDR family oxidoreductase | - |
| OOZ54_RS17150 (OOZ54_17150) | 3659845..3661377 | - | 1533 | WP_011158748.1 | acyl-CoA carboxylase subunit beta | - |
| OOZ54_RS17155 (OOZ54_17155) | 3661657..3662073 | + | 417 | WP_271100254.1 | DUF4260 domain-containing protein | - |
| OOZ54_RS17160 (OOZ54_17160) | 3662075..3662350 | - | 276 | WP_164604882.1 | EscU/YscU/HrcU family type III secretion system export apparatus switch protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10534.19 Da Isoelectric Point: 10.6525
>T267339 WP_271100252.1 NZ_CP115713:3658009-3658293 [Rhodopseudomonas palustris]
MIQGFRGKFARAILHDRKAPKGLPADLLGTARRKLVQLNAAAALADLAIPPGNRLEALRGDLQGLHSIRINDQWRIVFRW
KDTGPEDVEIVDYH
MIQGFRGKFARAILHDRKAPKGLPADLLGTARRKLVQLNAAAALADLAIPPGNRLEALRGDLQGLHSIRINDQWRIVFRW
KDTGPEDVEIVDYH
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|