Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 2904283..2904871 | Replicon | chromosome |
Accession | NZ_CP115713 | ||
Organism | Rhodopseudomonas palustris strain k7 |
Toxin (Protein)
Gene name | graT | Uniprot ID | B3QH83 |
Locus tag | OOZ54_RS13640 | Protein ID | WP_012495961.1 |
Coordinates | 2904283..2904570 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | OOZ54_RS13645 | Protein ID | WP_012495962.1 |
Coordinates | 2904584..2904871 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OOZ54_RS13615 (OOZ54_13615) | 2899829..2901334 | + | 1506 | WP_271099828.1 | caspase family protein | - |
OOZ54_RS13620 (OOZ54_13620) | 2901389..2902225 | - | 837 | WP_271099829.1 | helix-turn-helix transcriptional regulator | - |
OOZ54_RS13625 (OOZ54_13625) | 2902324..2903229 | + | 906 | WP_271099830.1 | SDR family oxidoreductase | - |
OOZ54_RS13630 (OOZ54_13630) | 2903263..2903451 | - | 189 | WP_271102874.1 | hypothetical protein | - |
OOZ54_RS13635 (OOZ54_13635) | 2903671..2904141 | - | 471 | WP_271099831.1 | hypothetical protein | - |
OOZ54_RS13640 (OOZ54_13640) | 2904283..2904570 | + | 288 | WP_012495961.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OOZ54_RS13645 (OOZ54_13645) | 2904584..2904871 | + | 288 | WP_012495962.1 | HigA family addiction module antitoxin | Antitoxin |
OOZ54_RS13650 (OOZ54_13650) | 2904884..2906935 | - | 2052 | WP_119018300.1 | DNA topoisomerase IV subunit B | - |
OOZ54_RS13655 (OOZ54_13655) | 2907393..2907923 | + | 531 | WP_119018301.1 | DedA family protein | - |
OOZ54_RS13660 (OOZ54_13660) | 2908009..2908998 | + | 990 | WP_271099832.1 | MBL fold metallo-hydrolase | - |
OOZ54_RS13665 (OOZ54_13665) | 2909143..2909688 | - | 546 | WP_271099833.1 | DUF2087 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11047.69 Da Isoelectric Point: 10.2688
>T267338 WP_012495961.1 NZ_CP115713:2904283-2904570 [Rhodopseudomonas palustris]
MIRSWRNAATRKLWDGSRFDQFRGLDVEAAIDLLLALNAAKSLQDLSPLQSVGLHKLKGVRRNQWAMTVNDRWRICFEFR
KGDAFEVEIVDYHKG
MIRSWRNAATRKLWDGSRFDQFRGLDVEAAIDLLLALNAAKSLQDLSPLQSVGLHKLKGVRRNQWAMTVNDRWRICFEFR
KGDAFEVEIVDYHKG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|