Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 1873686..1874331 | Replicon | chromosome |
| Accession | NZ_CP115712 | ||
| Organism | Kosakonia pseudosacchari strain RX.G5M8 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | PF050_RS08895 | Protein ID | WP_271069827.1 |
| Coordinates | 1873686..1874024 (+) | Length | 113 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PF050_RS08900 | Protein ID | WP_086873084.1 |
| Coordinates | 1874029..1874331 (+) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PF050_RS08875 (PF050_08875) | 1868937..1869677 | + | 741 | WP_271069823.1 | adenosylcobinamide-GDP ribazoletransferase | - |
| PF050_RS08880 (PF050_08880) | 1869705..1870763 | + | 1059 | WP_271069824.1 | nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase | - |
| PF050_RS08885 (PF050_08885) | 1870803..1871114 | - | 312 | WP_271069825.1 | helix-turn-helix domain-containing protein | - |
| PF050_RS08890 (PF050_08890) | 1871352..1873454 | + | 2103 | WP_271069826.1 | elongation factor G | - |
| PF050_RS08895 (PF050_08895) | 1873686..1874024 | + | 339 | WP_271069827.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PF050_RS08900 (PF050_08900) | 1874029..1874331 | + | 303 | WP_086873084.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| PF050_RS08905 (PF050_08905) | 1874414..1875364 | + | 951 | WP_271070127.1 | L,D-transpeptidase | - |
| PF050_RS08910 (PF050_08910) | 1875508..1876533 | + | 1026 | WP_097399495.1 | LLM class flavin-dependent oxidoreductase | - |
| PF050_RS08915 (PF050_08915) | 1876703..1877179 | + | 477 | WP_086873081.1 | cold shock domain-containing protein | - |
| PF050_RS08920 (PF050_08920) | 1877425..1877964 | + | 540 | WP_097399496.1 | DUF2058 domain-containing protein | - |
| PF050_RS08925 (PF050_08925) | 1878002..1878247 | + | 246 | WP_097399497.1 | DUF2543 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 1878359..1879519 | 1160 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 113 a.a. Molecular weight: 13030.11 Da Isoelectric Point: 10.3533
>T267326 WP_271069827.1 NZ_CP115712:1873686-1874024 [Kosakonia pseudosacchari]
MTQTFEKWFDALGDNDRASVLAALMVLRVKGPQLPRPYADTVKGSRYNNMKELRIQSRGEPFRVFYAFDPQRVGILLCAG
NKASNEKRFYDVMIQIADRELTRHLHKIKIKE
MTQTFEKWFDALGDNDRASVLAALMVLRVKGPQLPRPYADTVKGSRYNNMKELRIQSRGEPFRVFYAFDPQRVGILLCAG
NKASNEKRFYDVMIQIADRELTRHLHKIKIKE
Download Length: 339 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|