Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
Location | 3903210..3903807 | Replicon | chromosome |
Accession | NZ_CP115707 | ||
Organism | Klebsiella pneumoniae strain CPE16 |
Toxin (Protein)
Gene name | higB | Uniprot ID | R4YIC5 |
Locus tag | PGD48_RS19165 | Protein ID | WP_004142563.1 |
Coordinates | 3903490..3903807 (-) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | R4YH91 |
Locus tag | PGD48_RS19160 | Protein ID | WP_004142561.1 |
Coordinates | 3903210..3903497 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PGD48_RS19130 (3899290) | 3899290..3899538 | + | 249 | WP_002893037.1 | DUF1158 domain-containing protein | - |
PGD48_RS19135 (3899556) | 3899556..3899897 | - | 342 | WP_159174530.1 | RamA family antibiotic efflux transcriptional regulator | - |
PGD48_RS19140 (3899928) | 3899928..3901043 | - | 1116 | WP_020316605.1 | MBL fold metallo-hydrolase | - |
PGD48_RS19145 (3901223) | 3901223..3901804 | + | 582 | WP_043906838.1 | TetR/AcrR family transcriptional regulator | - |
PGD48_RS19150 (3901804) | 3901804..3902172 | + | 369 | WP_004142557.1 | MmcQ/YjbR family DNA-binding protein | - |
PGD48_RS19155 (3902292) | 3902292..3902942 | + | 651 | Protein_3760 | oxygen-insensitive NAD(P)H nitroreductase | - |
PGD48_RS19160 (3903210) | 3903210..3903497 | - | 288 | WP_004142561.1 | helix-turn-helix transcriptional regulator | Antitoxin |
PGD48_RS19165 (3903490) | 3903490..3903807 | - | 318 | WP_004142563.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PGD48_RS19170 (3903992) | 3903992..3905035 | - | 1044 | WP_004178895.1 | DUF2157 domain-containing protein | - |
PGD48_RS19175 (3905702) | 3905702..3906568 | - | 867 | WP_004178894.1 | helix-turn-helix transcriptional regulator | - |
PGD48_RS19180 (3906677) | 3906677..3908104 | + | 1428 | WP_004176980.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12110.39 Da Isoelectric Point: 11.2767
>T267310 WP_004142563.1 NZ_CP115707:c3903807-3903490 [Klebsiella pneumoniae]
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M5MXH8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0S3DIQ1 |